Vous êtes ici : Accueil » Cartes blanches

>>Haïti : actualité pour longtemps. Le monolinguisme créole est-il une utopie ? La fin du mandat de la Minustah.




Nous reproduisons ici l’article publié par
Robert Berrouët-Oriol sur son site www.berrouet-oriol.com, et dans Le National . En mettant l’accent sur le problème réel de la cohabitation des deux langues, créole et français, l’auteur rappelle l’influence pernicieuse que les USA tentent d’exercer à Haïti à travers certains "scientifiques" et diverses ONG opportunistes (pour ne parler que de ceux-ci).

Montréal, 31 Juillet 2017

Le « monolinguisme » créole est-il une utopie ?

Robert Berrouët-Oriol

« Le monolinguisme du ridicule » (Verly Sylvestre, Le National, Port-au-Prince, 26 juillet 2017) expose un corps d’idées intéressantes notamment en ce qu’il pointe du doigt le refoulement discriminant de la langue créole dans nombre d’écoles en Haïti où des enfants sont encore punis lorsqu’ils s’expriment de façon tout à fait légitime en créole. Avec justesse, l’auteur de l’article rappelle que la minorisation institutionnelle du créole est une pratique anti-pédagogique encore largement assumée en Haïti dans le corps professoral en dépit des aspects positifs de la réforme Bernard des années 1980. Cela étant, il y a lieu toutefois d’apporter un certain éclairage sur l’un ou l’autre volet de l’article de Verly Sylvestre.

Il est conforme à la réalité historique de qualifier Haïti de pays FRANCOCRÉOLOPHONE au sens où deux langues, le français et le créole, coexistent dans les appareils d’État, dans le système éducatif et dans la population selon un usage différencié. La réalité du patrimoine linguistique bilingue et bi-séculaire haïtien –qu’il est illusoire et vain de nier au prétexte réducteur de « l’exclusion de la majorité créolophone unilingue »–, est attestée à travers l’histoire du pays dans différents champs de la vie nationale comme nous l’avons montré dans le livre de référence « L’aménagement linguistique en Haïti : enjeux, défis et propositions » (Cidihca et Éditions de l’Université d’État d’Haïti, 2011). Alors même que le créole demeure « la langue qui unit tous les Haïtiens » (article 5 de la Constitution de 1987), qu’il est la langue usuelle des sujets parlants nés et élevés au pays, il est contre-productif sinon aberrant –comme veulent le faire croire certains linguistes haïtiens formés aux États-Unis–, que le français serait une langue étrangère en Haïti au même titre que le finlandais ou le japonais. Et accréditer la ritournelle selon laquelle « ceux qui ont le français comme langue maternelle, ils sont en nombre insignifiant selon Yves Dejean » revient à poser faussement la question de la coexistence de nos deux langues officielles. Prendre appui sur certains errements idéologiques du linguiste Yves Dejean dont la langue maternelle est le français, s’avère, encore une fois, improductif, car ces errements conduisent à enfermer la question linguistique haïtienne au périmètre d’une borgne comptabilité et à l’y réduire. En effet, il faut savoir qu’aujourd’hui, aucune enquête sociolinguistique d’envergure nationale menée par une institution haïtienne n’a apporté de données crédibles et vérifiables sur le nombre de locuteurs du français en Haïti : représentent-ils 5 %, 10 %, 15 %, 25 % de la population ? De son côté, l’Organisation internationale de la Francophonie (OIF) –citant le Rapport sur le développement humain (PNUD, 2010) et World Population Prospects The 2008 Revision (Division des affaires économiques et sociales des Nations Unies, 2008)–, estimait en 2010 le nombre de locuteurs de français en Haïti à 4 279 000 personnes sur un total de 10 188 000 habitants. Une fois de plus, il faut prendre toute la mesure qu’au-delà du nombre de locuteurs du français parlé en Haïti, l’aspect central de la question demeure le statut réel des deux langues officielles dans le corps social, leur mode de fonctionnement institutionnel en cohabitation inégalitaire et le fait, discriminant, que le créole n’est toujours pas une langue d’emploi obligatoire dans la totalité du système national d’éducation.

De même, aucune recherche à l’échelle nationale n’a jusqu’ici permis de mesurer la compétence linguistique des sujets parlant français chez les enseignants comme parmi les étudiants. En revanche, ce qu’il importe de bien comprendre, ce sont les conditions réelles de la coexistence inégale de nos deux langues officielles dans un dispositif qui alimente ce qu’il faut bien nommer, en particulier dans le système éducatif national, un aveugle apartheid linguistique dans le contexte de l’inexistence d’une politique d’État d’aménagement linguistique (voir Robert Berrouët-Oriol : « Les grands chantiers de l’aménagement linguistique d’Haïti (2017 – 2021) » ; voir aussi Robert Berrouët-Oriol et Hugues Saint-Fort : La question linguistique haïtienne / Textes choisis, Éditions Zémès, juin 2017).

Le Centre national de ressources textuelles et lexicales (CNRS, France), définit comme suit le « monolinguisme » : « État d’une personne qui ne parle qu’une langue, d’un pays où l’on ne parle qu’une seule langue ». Si l’observation empirique de la réalité linguistique du pays permet de poser que les unilingues créolophones constituent la majorité des sujets parlants, on ne saurait rigoureusement soutenir qu’Haïti est « un pays où l’on ne parle qu’une seule langue ». Haïti est un pays de langues en contact au sens où il existe bien une dynamique inégalitaire des usages du français et du créole, mais il serait tout aussi vain de nier qu’en raison des flux migratoires des 20e et 21e siècles et des échanges économiques entre Haïti et ses voisins, les langues sœurs anglaise et espagnole sont également parlées au pays par un nombre indéterminé de locuteurs.

Ainsi, soutenir l’idée qu’« Il faut tirer les conséquences du fait qu’Haïti est un pays essentiellement monolingue (…) Haïti est des plus monolingues des pays monolingues » (Yves Dejean : « Rebati, 12 juin 2010) revient à s’enfermer dans une dommageable myopie idéologique et linguistique qui pourrait faire obstacle à l’aménagement simultané des deux langues officielles du pays ainsi qu’à l’ouverture assumée au multilinguisme de notre modernité de sujets parlants.

À répéter hors de toute analyse crédible et de manière habitudinaire le cliché selon lequel « le français est un butin de guerre » en Haïti, et qu’il y a au pays « des francolâtres (…) des francoaphones, il s’agit alors des 95 % qui ne connaissent pas le français, eux qui vivent dans un territoire dit francophone tout en étant privés des bienfaits présumés d’une telle francophonie » revient à enfermer la question linguistique haïtienne au périmètre des approximations idéologiques. Il en résulte la négation complaisante du « droit à la langue », du droit constitutionnel de tous les locuteurs haïtiens à la possession de la langue française par une scolarisation de qualité en phase avec les droits linguistiques de toute la population. Quel en est l’enjeu ?

Le combat multiforme pour la langue créole est une tâche historique –j’en fais le plaidoyer depuis plusieurs années dans mes livres et articles. Mais, ce combat ne doit pas être opposé au français ni être réduit à une obtuse et une rituelle folklorisation de la langue créole elle-même. À contre-courant des approximations et des errements idéologiques, il s’agit aujourd’hui de porter sur les fronts institutionnels, et notamment à l’École de la République, LA VISION DE L’AMÉNAGEMENT CONCOMITANT DES DEUX LANGUES OFFICIELLES DU PAYS (voir à ce sujet, Robert Berrouët- Oriol, « Plaidoyer pour la création d’une Secrétairerie d’État aux droits linguistiques en Haïti », Le National 18 et 19 avril 2017, et http://www.ameriquelatine.msh-paris.fr/spip.php ?article895. On mesurera l’impact du futur aménagement simultané de nos deux langues officielles à l’École de la République en rappelant que « Selon l’Unicef, « Le système éducatif haïtien accueille 2 691 759 élèves dans 15 682 écoles. Alors que le secteur public reçoit 20% des élèves (538 963) dans 9% des écoles (1 420 écoles publiques), le secteur non public accueille 80% des élèves (2 152 796) dans 91% des écoles (14 262 écoles non publiques » (Unicef : « L’éducation fondamentale pour tous »).

De manière judicieuse, Verly Sylvestre pointe du doigt « Ce monolinguisme [créole] excommunié de l’incapacité de l’État à lui faire jouer son rôle dans le développement du pays. » Mais il faut aller plus loin dans le diagnostic et en tirer les conséquences : « Ce monolinguisme [créole] excommunié » se nourrit de préjugés sociaux tenaces et aveugles ; également, il est alimenté par l’absence quasi totale de leadership de l’État haïtien en matière d’aménagement linguistique, l’absence de vision articulée de la question linguistique nationale ainsi que le déni des droits linguistiques de la totalité de la population.

Le combat multiforme pour la langue créole, une tâche historique : il faut le mener sur le terrain institutionnel selon la vision des droits linguistiques. En clair, c’est précisément cette vision nouvelle et rassembleuse qu’il s’agit de promouvoir dans le corps social haïtien, dans nos institutions et parmi les décideurs politiques du pays.

Cette vision nouvelle ainsi que la configuration des droits linguistiques au pays figurent dans le livre de référence « L’aménagement linguistique en Haïti : enjeux, défis et propositions » ; elles sont rigoureusement conformes à la « Déclaration universelle des droits linguistiques » de 1996. Partant du principe que les droits linguistiques sont à la fois individuels et collectifs, qu’ils constituent des droits personnels inaliénables, nous les avons identifiés au titre des droits humains fondamentaux. Cette neuve manière de problématiser la question linguistique haïtienne, à contre-courant de l’approche « militantiste » et de l’enfermement identitaire/essentialiste, permet de circonscrire l’aménagement des deux langues officielles du pays sur le terrain des droits citoyens et des obligations de l’État car l’aménagement linguistique est en amont une question politique, une intervention planifiée de l’État dans le domaine linguistique (Jacques Maurais : « Politique et aménagement linguistiques », 1987). Les notions qui sont au fondement de cette vision sont celles de « patrimoine linguistique bilingue », de « droits linguistiques », de « droit à la langue », de « droit à la langue maternelle » créole, « d’équité des droits linguistiques », de future « parité statutaire entre les deux langues officielles », de « didactique convergente créole-français », de « politique linguistique d’État » et de « législation linguistique contraignante ». Elles doivent régir toute entreprise d’État d’aménagement simultané des deux langues officielles d’Haïti.


Avril 2017

On parle finalement assez peu d’un événement majeur pour la République d’Haïti : la fin programmée de la présence de la Minustah de l’ONU après treize ans de services pas toujours bons ni absolument loyaux.

Il reviendra bien sûr au pays d’assurer ensuite pleinement les missions de sécurité qui incombaient à la Minustah. Les forces de police locales de la PNH (un peu moins de 13,000 agents aujourd’hui) participeront donc à des exercices de formation d’ici deux ans. La résolution du Conseil de sécurité de l’ONU prévoit que 2,360 soldats auront quitté le pays au 15 octobre de cette année, après la fin de la prorogation du mandat pour la stabilisation. Prendront le relais pour six mois initiaux sept unités de police constituées (980 hommes), ainsi que 295 policiers hors unités constituées, qui formeront la Minujusth. En plus de sa mission de formation, celle-ci sera également chargée de veiller à la mise en place edes mesures adéquates en matière de droits humains, d’en rendre compte et de les analyser.

Vu de l’extérieur, on craint l’éventualité d’un retour d’une police politisée, mon redoute une recrudescence de la contrebande d’armes et du trafic de drogues. Mais, finalement, n’est-ce pas une occasion pour le pays de se prendre en mains en ces matières aussi ?

Vraiment ? On finit par se le demander, car la décision de l’ONU vient en partie de la volonté de l’administration Trump de réduire officiellement les sommes transitant par l’ONU pour les opérations de sécurité de celle-ci. De toute façon, l’influence des USA à Haïti reste assurée politiquement et économiquement, directement ou à travers des actions menées par certaines ONG ou des groupes religieux de type pentecôtiste. Pourquoi, en avançant des arguments confortables, payer davantage lorsque ce n’est plus tout à fait nécessaire ?



3 janvier 2017

Les résultats définitifs de l’élection présidentielle confirment les estimations premières ; ils donnent Jovenel Moïse gagnant avec 55,60% des voix, devant Jude Célestin (parti Lapeh) avec 19,57 %. Il faudra à présent que le vainqueur, apparemment éloigné jusqu’alors de la politique, gagne une légitimité que la minceur du nombre des votants ne semble pas lui accorder d’emblée.


Paris, 28 novembre 2016

Laënnec Hurbon nous a accordé un entretien à l’occasion d’un passage à Paris au cours duquel il expose la situation, toujours incertaine, qui règne dans le pays à la suite des élections présidentielles qui viennent d’avoir lieu. Et c’est évidemment l’occasion de revenir sur les derniers malheurs qui ont frappé Haïti, avec des conséquences dues autant au manque d’infrastructures solides (par la faute d’un pouvoir local largement défaillant) qu’à la responsabilité d’une partie de la communauté internationale. Et bien sûr, on ne saurait oublier à cet instant exceptionnel l’appartenance du pays aux Caraïbes, et les effets de la proximité de Cuba sur la politique interne.

Aux dernières nouvelles, Jovenel Moïse, le candidat choisi par l’ancien président Michel Martelly, lui-même téléguidé par les États-Unis et Hillary Clinton, aurait été élu dès le premier tour devant Jude Célestin, du parti Lapeh. "A quoi bon tout ça ?" ont dû s’interroger les électeurs confrontés à un trop-plein de candidatures et à la vacuité des programmes, puisque le taux de participation n’aurait atteint que... 21,69%. L’annonce officielle des résultats définitifs est prévue pour la fin décembre.


Laënnec Hurbon 28-11-2016 par Dominique Fournier




Port-au-Prince, 1er août 2016

Voici un texte d’humeur, pas foncièrement optimiste sur l’avenir immédiat du pays, qui nous a été transmis par notre ami Laënnec Hurbon, et qui a été initialement présenté à l’émission Point du Jour sur Radio IBO le lundi 25 juillet 2016

LA LOGIQUE DU CHAOS...

Hérold Jean-François

Nous nous acheminons vers une dévaluation conséquente de notre Gourde qui dégringole de jour en jour à chaque nouvelle transaction et dans les super marchés, l’ajustement des prix est déjà effectif. On paie déjà de 10 à 26% plus cher pour certains produits, comparée à la mi-juillet 2016.

La zone métropolitaine de la capitale augmente en laideur tous les jours et l’hygiène publique est devenue un véritable défi. Il faut peut-être revenir à 1989 où nous avions un sérieux déficit dans le ramassage des ordures pour trouver une situation d’insalubrité aussi préoccupante. L’État est dépourvu de moyens, l’économie est exsangue, les difficultés des uns et des autres pour faire face aux obligations renvoient à une situation de pré-faillite. L’économie est en mode décroissant, les prévisions de croissance sont revues à la baisse suivant les données des autorités monétaires, le défaut d’investissements, l’arrêt des chantiers publics, l’assèchement des fonds du Petro Caribe, le désengagement du financement international, le gel de la coopération bilatérale sont autant d’aspects qui font que l’étouffement d’Haïti est garanti.

Or nous prétendons nous assumer pleinement en ignorant l’argent de l’étranger que l’on avait à tort comptabilisé dans notre Budget national, pour financer nos élections et faire comme si les choses allaient bien en affichant un train de vie insolent pendant les cinq dernières années d’un pouvoir aussi bambocheur que prédateur.

En octobre 2016 nous prévoyons d’aller aux élections pour mettre fin à la déconstruction démocratique planifiée sciemment par l’administration Martelly. Tout le monde est d’accord pour qu’Haïti relève la tête et initie le rapatriement de ses prérogatives de souveraineté en garantissant le financement du processus électoral à partir des ressources internes. Il va falloir être ingénieux pour trouver l’argent nécessaire en détournant des rubriques dans l’ancien Budget, car le Parlement insouciant que nous avons avait boudé la convocation du Président provisoire au menu duquel figurait le vote d’un Budget rectificatif. Ou il faudra aller sur le marché emprunter de l’argent dans les réserves disponibles, ou souscrire un emprunt public en utilisant les mécanismes du système.

Ce sont là autant d’hypothèques sur le prochain mandat régulier. Le Président qui sortira des prochaines élections devra avoir des reins solides, une détermination de fer et de l’imagination pour nettoyer les écuries d’Augias et mettre de l’ordre en imposant des sacrifices chez un peuple habitué certes à la souffrance, aux privations et à des conditions de vie extrêmes, mais peu enclin à se conformer à des cures amaigrissantes suivant le modèle de ce que l’on a vu à Cuba de 1959 à nos jours. Et dans notre cas, n’est-il pas difficile d’imaginer imposer plus de restrictions encore à un peuple dont les données des institutions financières indiquent que sa grande majorité survit avec moins de 2 dollars américain par jour, soit 128.80 gourdes au taux de 64.40 gourdes pour 1 dollar, le 25 juillet 2016 ?

Mais qui se soucie en Haïti des données statistiques, des chiffres indiquant toutes sortes de malaises et de déséquilibres macro-économiques ? Nos politiciens ? Nous savons tous déjà qu’Haïti est une République d’individus où les intérêts personnels des uns ne leur laissent pas le temps de se lamenter sur les difficultés du reste de la population. Si vous aviez besoin d’un exemple, tournez le regard sur le Parlement en auto-veilleuse depuis des mois et où de façon miraculeuse on a pu tenir une séance le 20 juillet dernier, le temps d’accorder décharge de leur gestion à deux Sénateurs, un Questeur et un ancien Président du Grand Corps. En d’autre temps, il faudra revenir et questionner certaines pratiques qui se donnent libre cours au Parlement en matière de reddition de comptes... Ici, on n’est dans un monde non-orthodoxe... Les normes qui s’appliquent ailleurs en matière de contrôle des actes et de la gestion des deniers publics se règlent de manière débonnaire, à la bonne franquette. Le temps de dire pour assis contre debout comme cela se faisait à la Chambre unique des Duvalier, le rapport de gestion des comptables des Chambres législatives est libéré, et le parlementaire en question a les coudées franches pour se porter candidat et revenir à la charge, avec la plus grande complicité de ses pairs... Pauvre peuple, cadet des soucis de ses mandataires !...

DE LA CLASSE POLITIQUE HAÏTIENNE...

Bizarroïde serait le mot qui conviendrait pour qualifier nos femmes et nos hommes politiques. Elles et ils agissent à l’opposé de ce qu’elles ou ils disent. Ils combattent les élections, mais ils se portent candidats aux mêmes élections. Le premier qui dénonce la convocation par le Président provisoire du peuple dans ses comices est celui-là même qui, à l’encontre de ses convictions et positions tapageuses dans les médias quant à la réalité au Grand Corps, se compromet en faisant toutes les contorsions pour que séance se tienne afin d’obtenir décharge de sa gestion et s’inscrire en bonne et due forme pour participer aux élections dont il vient juste de condamner la convocation par le chef de l’État ! Hypocrisie !

Et par rapport aux autres qui condamnent le fait que Jocelerme Privert convoque le peuple pour aller voter aux élections en invoquant par ailleurs son défaut de qualité pour le faire, que comprendre de cette attitude ?

Depuis le 14 février 2016, nous sommes dans une situation de fait. Nous avons un Président hors-norme sorti des artifices de l’interprétation de l’article 149 de la Constitution amendée. Or nous savons tous que si ce n’est simplement l’esprit dudit article, il n’y a rien dans sa lettre qui correspondait à la réalité politique d’Haïti au 7 février 2016. Nous soumettons à votre attention, pour rappel, les prescrits de l’article 149 de la Constitution de 1987 amendée.
"En cas de vacance de la Présidence de la République soit par démission, destitution, décès ou en cas d’incapacité physique ou mentale permanente dûment constatée, le Conseil des Ministres, sous la présidence du Premier Ministre, exerce le Pouvoir Exécutif jusqu’à l’élection d’un autre Président.
Dans ce cas, le scrutin pour l’élection du nouveau Président de la République pour le temps qui reste à courir a lieu soixante (60) jours au moins et cent vingt (120) jours au plus après l’ouverture de la vacance, conformément à la Constitution et à la loi électorale.
Dans le cas où la vacance se produit à partir de la quatrième année du mandat présidentiel, l’Assemblée Nationale se réunit d’office dans les soixante (60) jours qui suivent la vacance pour élire un nouveau Président Provisoire de la République pour le temps qui reste à courir."

Vous êtes d’accord que rien de ce qui précède ne correspondait à la situation de Michel Martelly qui a épuisé les dernières secondes de son mandat de cinq ans dont il a JOUI pleinement... Dans ce cas, l’élection de Jocelerme Privert au second degré est plus le résultat de l’acceptation d’un fait accompli, à la lumière de l’esprit de l’article 149 de la Constitution. L’épuisement des 120 jours alloués sans que les tâches à accomplir l’aient été effectivement, fait-il de Privert un Président avec moins de légitimité qu’avant ? Nous ne le pensons pas. Et si nous étions dans une situation où la classe politique se souciait uniquement du bien de la nation, sans à priori idéologique basé sur des objectifs peu nobles comme prendre le contrôle du pays par l’intermédiaire d’un nouveau Président "pope twal", depuis le 14 juin dernier, l’Assemblée Nationale se serait réunie sans idée préconçue pour constater les faits et convenir de la poursuite de l’expérience, sans interruption, jusqu’à la passation de pouvoir, le 7 février 2017.

Mais il y a ceux qui ont d’autres agendas, ceux qui rêvent d’une transition sans fin conformément à leurs plans et projets qui ne sont pas toujours avouables... Les adversaires de Jocelerme Privert semblent avoir perdu la raison à un point tel qu’ils sont tout à fait déconnectés d’avec la réalité. Nous avons un train électoral en marche, jusqu’à présent, le processus est à jour et à l’heure ; nos donneurs de leçons de la communauté internationale semblent vouloir réajuster leur attitude ; le gouvernement gère tant bien que mal les affaires courantes ; le pays est dans un statu quo déprimant mais fonctionnel. Qui, dans le pays, est gêné par la présence de Jocelerme Privert ? Qui a véritablement aujourd’hui, comme priorité, un changement de Président provisoire ? Qui est incapable de comprendre que tout coup de frein à la marche actuelle des choses sera fatal pour le calendrier électoral tel que déployé ?

Les artisans de l’ombre et les forces des ténèbres guidant la main de l’insécurité qui frappe avec la dernière méchanceté n’ont pas encore réussi à retourner la vapeur en leur faveur en comptabilisant les morts issues de la violence planifiée en défaveur du pouvoir en place. Les actes spectaculaires pour créer la dynamique du chaos, on ne saurait les imputer à l’administration Privert/Jean-Charles. Au contraire, on serait plus enclin à les mettre au compte de ceux-là qui regrettent d’être partis trop tôt du pouvoir et qui rêvaient hier encore de permanence dans les meubles de l’État. Rêve contrarié par le rapport de la Commission d’Évaluation et de Vérification Électorale qui a poussé à l’annulation des présidentielles. Ceux qui ont la nostalgie du pouvoir sont en train de mal faire et de jouer mal. Ils n’ont pas les suffrages de l’opinion publique et leurs faux pas peuvent vite les mettre dans une posture de délinquants auxquels on créditera tous les forfaits récents. Les enquêtes du FBI sur les tirs sur les façades d’édifices appartenant au capital étranger ; les investigations en cours au niveau des institutions locales sur les mêmes agressions n’emprunteront-elles pas les mêmes canaux pour couler vers la même embouchure ? La faiblesse du pouvoir, son incapacité à traîner devant la justice des citoyens jusque-là intouchables, son laxisme qui a permis à des forces occultes d’agir en toute impunité en semant le deuil ici et là, ne sont-ce pas là un ensemble de reflets rejaillissant sur une certaine opposition et sur sa capacité à créer des situations dont elle pense pouvoir en être en même temps l’auteure et la dénonciatrice ?

Coup double, jeu malin, mais jeu dangereux. Parce que si l’on attaque ça-et-là, l’on tire sur des édifices, l’on active la main de l’insécurité qui frappe de manière aveugle et qu’en face le pouvoir est comme tétanisé et incapable de réagir, faut-il bien que quelque part, quelqu’un, un groupe ou une association de personnes soit derrière tout cela ? Alors, les observateurs tout comme l’opinion publique doivent se tarauder les méninges pour identifier les agresseurs. L’opposition frontale à Jocelerme Privert ne saurait sortir vierge de l’esprit ou de la perception de chacun quant à l’actuelle réalité taillée sur mesure pour les besoins d’une cause pour le moins perdue, nous semble-t-il...




Port-au-Prince, 11 juillet 2016

Après quelques hésitations, nous avons choisi de reprendre ces articles parus très récemment dans Le National parce qu’ils traitent de sujets, le système éducatif et la langue française, d’un intérêt supérieur pour le pays, à divers titres.

Le National, lundi 11 juillet 2016, n°280

TRIBUNE

Deux mots sur le système éducatif haïtien

Ceteris paribus, l’histoire du système éducatif haïtien peut se caractériser par deux points fondamentaux : 1- Le refus des élites haïtiennes de construire un système éducatif dynamique et performant en faveur du peuple ; 2- Le non-accès généralisé du peuple haïtien à une éducation de base. C’est à travers ce carrefour perplexe que les demandes scolaires se prononçaient et allaient être un instigateur principal dans la constitution du système éducatif haïtien au lendemain de la révolution de 1843.

L’éducation scolaire dans notre article prend le sens de socialisation – en termes de valeurs véhiculées dans le système scolaire de manière euphémique – elle s’apparente aussi à l’instruction scolaire dans le contexte de l’enseignement — apprentissage que celle-ci a pour première mission. Ainsi, le concept d’éducation scolaire recouvre ces deux versants.

L’entrée à l’école en Haïti se vit comme un « choc culturel » par le jeune écolier : de prime abord, causé par la langue française, c’est le premier contact direct de l’élève avec celle-ci. La langue française est le langage d’une minorité d’individus dans la société haïtienne et elle est généralement l’apanage des classes bourgeoises et moyennes. Les codes sociolinguistiques révèlent l’inégale distribution du pouvoir sur le marché des échanges linguistiques : le code élaboré, formel et universaliste est la langue française adoptée à l’école. Par conséquent, les élèves des milieux sociaux défavorisés doivent « changer de code », comme on dit souvent, ils doivent « s’exprimer ».

Par ailleurs, les bagages axiologiques qui structurent le milieu scolaire haïtien sont généralement contradictoires – par rapport à celles qui sont véhiculées dans les familles haïtiennes, notamment paysannes, les valeurs communautaires [Gemeinschaft] de type volonté organique se trouvaient confrontées à des valeurs sociétales [Gesellschaft] à volonté réfléchie. L’éthos des classes dominantes, basé sur la distinction, le dégoût des goûts des classes populaires, sont les principales orientations véhiculées à l’école.

Les écarts socioculturels entre l’écolier et son milieu socioenvironnemental croissent à mesure que le jeune Haïtien atteint un niveau graduel dans les cycles scolaires du système éducatif : l’école, qui devrait être un moyen méthodique et interactif de la jeune génération avec la société, produit des Haïtiens dotés d’un habitus bourgeois qui les conduit le plus souvent à une dissonance culturelle, frisant dans la pratique une dyssocialisation, en l’occurrence l’étudiant prince auto-dominé selon les analyses du professeur Anil Louis-Juste est un idéal type. La culture scolaire est un enjeu social – arbitraire culturel –, elle renforce les inégalités sociales et scolaires dans la société haïtienne comme l’a si bien analysé Louis Auguste Joint dans son livre Système éducatif et inégalités sociales en Haïti (2006).

Le système éducatif haïtien tend à reproduire les antagonismes bi-catégoriaux classiques entre les créoles et les bossales dans la société haïtienne : les pratiques éducatives et les formes scolaires qui s’y développent révèlent, entre autres, la relation que ces dernières entretiennent avec les structures politiques et sociales. Le système scolaire haïtien forme des désubstantialisés, des homo-sapientissistes ; à cet effet, Bird M.B. avance ceci : « L’éducation reçue par le petit nombre en Haïti et ailleurs n’a pas été de nature à inspirer chez ces personnes de la sympathie pour les masses ignorantes (…), l’éducation du petit nombre en Haïti a produit le sentiment d’une certaine supériorité qui, à son tour, a engendré un grand orgueil. » Le non-accès généralisé à l’éducation scolaire des enfants en âge de scolarisation, les problèmes de l’alphabétisation des masses paysannes et urbaines, l’école à deux vitesses avec des effets socio-éducatifs non moins importants comme l’effet établissement, l’effet maître, l’effet classe, restent des défis importants à relever en dépit de quelques efforts réalisés ces dernières années.

Une autre problématique essentielle et légitime à poser si on veut comprendre le système éducatif haïtien relativement à ses fins est la suivante : le système éducatif haïtien a-t-il comme finalité de produire des êtres dotés d’une conscience critique ? Est-il porteur d’une civilisation adaptée aux contextes nationaux et internationaux ? Est-ce une éducation pour le développement durable ? Une telle éducation est-elle apte à émanciper l’Homo haitianus ? D’aucuns soutiennent que ce système éducatif s’avérerait inadapté aux contextes local et global – en dehors des problèmes administratifs et organisationnels auxquels il fait face – ce qui nous intéresse ici, c’est le projet d’homme qu’il forme, cristallisé dans le cursus pédagogique du ministère de l’Éducation nationale et de la Formation professionnelle (MENFP). À priori, la structure d’un programme académique est montée selon une philosophie de l’homme et de la société, elle découle d’une certaine chronosophie futurocentrique, c’est-à-dire d’une vision globale de l’homme qui tient compte de son passé afin de viser un avenir investi d’un contenu rêvé, attendu ou souhaité, donc d’une idéologie. Elle tient compte des défis socio-économiques nationaux et de la mondialisation : in fine, comme le dit Gérard Boutin (2004), ce sont les postures philosophiques, psychologiques et politiques qui infléchissent les actions éducatives. Mutatis mutandis, des pays comme la France, les États-Unis, le Canada et la Chine incorporent des filières technologiques et professionnelles dans leurs cursus scolaires. Ainsi, les écoles secondaires en Chine comprennent des sections d’études agricoles et professionnelles ; celles du Québec incluent une formation professionnelle axée sur l’emploi dans leurs filières à partir de la classe de cinquième de l’enseignement secondaire, de même en France après le Diplôme national du Brevet (DNB), la classe de seconde s’ouvre sur trois orientations : professionnelle, technique et générale. Grosso modo, la structuration des cycles du système scolaire haïtien en vigueur révèle une inadéquation avec les grands enjeux de développement économique, social, politique, culturel auxquels fait face la société dans son ensemble. Les secteurs professionnel et technologique ne sont pas pris en considération – sur le plan pratique – dans le système éducatif haïtien : celui-ci forme majoritairement des élèves à orientation générale, ce qui cause en partie l’échec scolaire.

Le curriculum formel du ministère de l’Éducation nationale et de la Formation professionnelle est inadapté, les matières et les contenus ne sont pas contextualités : en l’occurrence, l’enseignement-apprentissage des sciences sociales et de la littérature se confinent à la moitié du XXe siècle. Le curriculum formel n’est pas mis en œuvre (tel que prévu par le MENFP) par les enseignants – catégories sociales qui sont en général peu qualifiées et sous-payées. Aucune matière ne traite des rapports haïtiano-dominicains ; l’éducation civique, politique et environnementale est pratiquement absente ; les NTICs ne sont pas intégrées de manière effective dans les salles de classe ; le problème pédagogique de l’enseignement des langues étrangères : l’anglais et l’espagnol sont à repenser. Quant aux sciences dures : la biologie, la chimie et les mathématiques, elles restent purement confinées à un stade intellectuel. Les pratiques scolaires sont inadaptées : le système éducatif haïtien est basé sur une approche comportementaliste de l’enseignement-apprentissage selon lequel l’élève est un sujet réceptif. En conséquence, l’élève haïtien est récalcitrant au travail de groupe et il devient totalement dépendant du professeur. Les fautes ne sont pas tolérées et sont ridiculisées dans les salles de classe ; l’élève est peu développé intellectuellement et son sens critique est rachitique : le produit de ce modèle est « l’élève-perroquet » avec une tête bien pleine plutôt que bien faite.

Les postures idéologiques et les représentations sociales transmises à travers l’organisation scolaire et au cours des interactions pédagogiques entre élèves ∕ professeurs ∕ administrateurs scolaires sont discriminatoires, ségrégationnistes et foncièrement individualistes : les rapports sociaux sont reproduits sans aucune censure dans les milieux scolaires haïtiens : la violence, l’asymétrie des sexes, les clivages de couleur, de région, de religion, de résidence. En fait, c’est une école qui ne permet pas la mixité sociale et elle s’assure "que ceux qui se ressemblent, s’assemblent". Les habitus des élèves en tant que dispositions permanentes et du fait de leur caractère de transposabilité, génèrent des pratiques similaires quand ils sont à l’université – institution qui reflète elle-même les différents problèmes sociétaux haïtiens. Ainsi, par une sélection sociale s’apparentant à un darwinisme social pour leur entrée à l’université, notamment l’Université d’État d’Haïti, certains d’entre eux incorporent le « sens pratique » des travaux universitaires jusqu’à l’obtention de leur diplôme : ce qui leur confère une certaine compétence culturelle ?

Feland Jean felandjean@yahoo.fr

— Fanon, Frantz, (1995). Peau noire, masques blancs, Paris, éd. du Seuil.
— Bird, M.B., cité par Toussaint, Hérold, (2004). Communication et État de droit selon Jürgen Habermas, patriotisme constitutionnel et reconnaissance de l’autre en Haïti, Port-au-Prince, éd. Deschamps,



A propos de la francophonie. Pour l’engagement citoyen des jeunes

Le dimanche 10 juillet a pris fin à l’Université de Montréal, dans la ville éponyme, le forum des jeunes ambassadeurs de la Francophonie des Amériques, qui a débuté le 3 Juillet dernier. À ce forum, prennent part de nombreuses personnalités distinguées de l’univers francophone, dont Christiane Taubira, l’ancienne garde des sceaux de la République française.

Cette année, 55 futurs jeunes ambassadeurs de 20 pays différents des Amériques, dont Haïti, prennent part à la 5e édition de l’événement. Ces ambassadeurs, âgés de 18 à 35 ans, suivront une formation à la fois théorique et pratique qui a pour objectif de les outiller pour devenir des citoyens engagés dans leur milieu. L’édition de cette année a aussi vu le lancement du livre Le seul passager noir du Titanic de Serge Bilé. Le livre traite de la présence de Joseph Philippe Lemercier Laroche, citoyen Haïtien et seul passager noir à avoir été à bord du célèbre paquebot.

Le bureau Montréal du Journal, dont la directrice, Sandrellie Séraphin, figure parmi les jeunes ambassadeurs du forum, a conçu ce supplément pour permettre aux lecteurs de saisir la portée de cet événement majeur, à travers les témoignages de certains participants.



Claire Falonne Barbara Francoeur, secrétaire au conseil d’administration de la Jeune chambre de commerce haïtienne (JCCH)

Le National : qu’est-ce que cela veut dire pour vous de participer au FJAF2016 ?

Claire Falonne Barbara Francoeur : Les langues sont une façon de voir le monde, de nommer les choses et les langues sont fécondes. (Christiane Taubira) Partageant cette même vision que madame Taubira, participer à la 5e édition du Forum des jeunes ambassadeurs de la Francophonie est une occasion pour moi de m’ouvrir au monde, de pouvoir nommer les choses telles qu’elles sont, d’aller à la rencontre de tous ceux qui partagent les mêmes valeurs que moi, d’aller vers ceux qui sont aux prises à cette crise identitaire, de partager nos expériences, proposer dans cette optique surtout de créer, d’innover et de reproduire.

C’est une occasion unique de me joindre à cette lutte de protection de la langue française, symbole de notre façon d’être, de penser, d’agir, de percevoir, et ce, tant dans nos relations avec les autres qu’avec l’environnement dans lequel nous, les francophiles, évoluons.

LN : quel est votre regard sur le fait français en Haïti ?

CFBF : En Haïti, la langue française a toujours été et est encore une question qui divise. Souvent considérée comme la langue de l’élite intellectuelle et économique, elle est minoritairement parlée par le peuple qui est majoritairement analphabète. Étant la langue d’enseignement, elle est vue comme le vecteur de préjugés des personnes pleinement accomplies. Or en Haïti, la chance n’est pas donnée à tous d’aboutir à cet accomplissement. Donc, chez nous, la langue n’est pas juste un moyen de communication, de penser et d’agir, mais c’est aussi un outil de classement social au détriment du créole qui est la langue maternelle parlée par la classe défavorisée. Dans cette quête de protection, de sauvegarde et de cohabitation de la langue française au côté du créole, langue maternelle, il s’avère judicieux, en Haïti, de se pencher sur l’enseignement des deux langues dès la maternelle. Dans cette optique, la Francophonie pourrait jouer un rôle clef dans ce renouement de la situation, ci-haut décrite comme le « fait français », en prônant les valeurs de solidarité et de justice sociale, de partage et du vivre ensemble. Surtout qu’Haïti n’est pas seul dans cette lutte où deux langues se confrontent incessamment au profit d’une classe élitiste.

LN : quels bénéfices vous pensez tirer de ce FJAF2016 ?

CFBF : D’éveiller cette conscience de l’urgence, de pouvoir discuter sur les grands enjeux sociaux, économiques et culturels similaires à une multitude de pays qui ont en commun un point vital : le FRANÇAIS, effigie de leur histoire coloniale, c’est pour moi plus qu’une opportunité, mais un engagement vers cette réconciliation pour l’avenir d’un monde juste et équitable. En tant qu’ambassadrice, je fais don de moi pour ainsi peu, à mon tour, changer ce monde tant rêvé. Je ne puis le décrire comme étant des bénéfices, mais bien le moment tant désiré pour passer à l’action.


Marc-Edwens Thélusma, originaire de Ouanaminthe, enseignant

Le National : qu’ est-ce que cela veut dire pour vous de participer au FJAF2016 ?

Marc-Edwens Thélusma : Depuis sa création en 2008, le centre de la Francophonie des Amériques a mis sur pied divers programmes qui reflètent sa mission. Ainsi, presque tous les deux ans le centre organise le forum des jeunes ambassadeurs de la Francophonie des Amériques dans le souci de permettre aux jeunes du continent américain de se rassembler, rencontrer des acteurs engagés en vue de la promotion d’une francophonie plus enrichissante. Autrement dit, l’objectif central du forum des Jeunes Ambassadeurs est d’offrir aux jeunes une formation de haut niveau axée sur le leadership et l’identité culturelle.

En effet, participer à cette 5e édition du forum des Jeunes Ambassadeurs de la Francophonie des Amériques représente pour nous une opportunité importante. Tout d’abord, ce sera pour nous l’occasion d’approfondir nos connaissances sur la Francophonie en tissant des liens durables avec d’autres jeunes leaders francophones de la région des Amériques dans le partage et le respect de la diversité culturelle.

Ensuite, la Francophonie dans les Amériques, c’est plus de 33 millions de francophones avec près de neuf millions pour Haïti, soit à peu près le tiers du nombre total de francophones dans la région. Donc, conscient de cette force que peut représenter Haïti dans le monde francophone ; des multiples enjeux de la Francophonie pour Haïti, ce sera également pour nous l’occasion ultime de faire un plaidoyer pour qu’Haïti puisse occuper valablement sa place, jouer son rôle de manière efficace au sein de la communauté francophone et, par conséquent, tirer des bénéfices des différents atouts de la francophonie, car selon notre vision, la francophonie c’est s’engager dans la construction d’un monde plus juste et plus égalitaire. La Francophonie est un atout pour Haïti. Quand nous parlons d’atouts, nous n’évoquons pas uniquement une Francophonie sur le plan linguistique, c’est-à-dire une francophonie promotrice uniquement de la langue française, mais nous voulons parler d’une Francophonie inclusive, mais pas dominatrice, une Francophonie qui valorisera aussi bien le français que le créole en Haïti.

Nous voulons parler également d’une Francophonie qui est facteur de développement économique pour Haïti, une francophonie qui permettra la valorisation et la promotion de la culture haïtienne, du tourisme haïtien, du savoir-faire et du savoir-être haïtiens. Cette Francophonie économique à laquelle nous faisons allusion trouvera sa matérialisation par la réalisation en Haïti de grands événements francophones comme une édition du forum des Jeunes Ambassadeurs, un festival de musique francophone et créolophone, les jeux de la francophonie, etc., ce qui constituera une rentrée économique pour Haïti.

En fin de compte, promouvoir la culture haïtienne, faire le plaidoyer pour un leadership haïtien au niveau de la francophonie dans la région des Amériques, c’est ce qui explique notre présence et notre mission dans le cadre de cette 5e édition du forum des jeunes ambassadeurs de la Francophonie des Amériques.

LN : quel est votre regard sur le français en Haïti ?

MET : Depuis la signature du concordat en 1860, les politiques publiques haïtiennes ont institué le français comme langue officielle. Ceci dit, il est non seulement la langue de scolarisation, mais également la langue utilisée au niveau de l’administration publique. D’un point de vue anthropologique, au regard du soi-disant bilinguisme haïtien, parler français est vu comme un signe de distinction sociale, un moyen d’affirmer son appartenance à une élite économique ou intellectuelle. C’est une stratégie politique de l’État de toujours maintenir la masse à l’écart de la sphère politique.

Cependant, tenant compte des réalités actuelles, de la proximité historique d’Haïti avec la France et avec pas mal de pays, de la réalité sociétale avec le français comme langue de scolarisation, de mon point de vue, le français peut constituer pour Haïti un vecteur d’ouverture sur le monde.

Alors, cette proximité du français avec le créole devrait contribuer à plus forte raison à la vitalité et à la promotion du créole en Haïti pour un bilinguisme efficace et efficient. Ce bilinguisme au niveau de la scolarisation facilitera non seulement « intégration effective des couches les plus défavorisées, mais également le rehaussement de l’éducation et de la culture haïtiennes.

LN : quels bénéfices pensez-vous tirer de ce FJAF2016 ?

MET : Comme nous l’avons si bien dit, cette 5e édition du forum des Jeunes Ambassadeurs de la Francophonie des Amériques, comme jeunes leaders du continent, nous permettra de nous rencontrer, d’échanger sur nos expériences et tisser des liens durables, d’être sensibilisés aux enjeux de la francophonie, mais surtout de nous outiller pour devenir citoyens engagés au sein de notre communauté.

Autrement dit, à la fin de ce forum nous aurons le titre de jeunes ambassadeurs de la Francophonie. Lequel titre nous permettra de contribuer à la vitalité de la francophonie au sein de la société haïtienne, de développer et consolider des liens durables avec d’autres partenaires de la francophonie des Amériques, ce qui peut constituer un atout pour Haïti. De surcroît, à la fin de ce forum, nous serons en mesure de contribuer à la création d’un sentiment d’appartenance d’Haïti à la francophonie. Également, nous contribuerons à donner accès à la francophonie en Haïti en mettant en valeur des personnalités, des artistes et spectacles francophones et créolophones. Déjà fort de cette belle expérience de leadership, de promotion de la diversité culturelle, de l’intensification du dialogue des cultures et des civilisations francophones des Amériques, ainsi, à la fin de ce forum, comme, jeunes ambassadeurs, Haïti peut compter sur nous, sur notre engagement citoyen, en ce sens que nous serons en mesure de contribuer efficacement à la promotion et à l’épanouissement de la francophonie en Haïti. En somme, nous nous engageons à servir la patrie, car nous croyons en une Haïti meilleure, nous croyons en une autre société plus égalitaire. Alors, nous engager dans la promotion de la francophonie et de la créolophonie, c’est nous engager dans la construction d’une Haïti plus juste et plus prospère, c’est nous engager dans l’épanouissement de la culture haïtienne, c’est nous engager dans la promotion d’une Haïti où la jeunesse aura vraiment sa place.


Le National : Qu’est-ce que cela veut dire pour vous de participer au FJAF2016 ?

Widlyn Dornevil : Les individus à travers le monde sont devenus humainement plus loin les uns des autres. Ce repli sur soi ne facilite pas le vivre ensemble capable d’apporter des solutions plus efficaces aux grands enjeux actuels du monde. Les forums internationaux comme celui-ci, offre un cadre idéal pour que les jeunes de plus de 20 pays de l’espace francophone de pouvoir se rencontrer, partager les expériences. Ce forum est pour moi l’occasion de faire partie de ce grand réseau pour aborder les problématiques communes de l’espace francophone notamment la valorisation de la diversité culturelle, la promotion de la paix et la solidarité entre les peuples.

LN : quel est votre regard sur le français en Haïti ?

WD : Le français en Haïti est institutionnalisé d’une façon à créer de l’exclusion sociale dans un pays encore déchiré par des clivages et de l’injustice sociale. Il est une nécessité de travailler à favoriser un climat de cohabitation entre les deux langues. La langue en tant qu’outil d’expression de la réalité peut aussi servir d’outil pour changer la réalité. Une cohabitation des deux peut faciliter l’inclusion sociale en Haïti. Le fait français fait partie de la mémoire collective haïtienne autant que le créole, donc il est du devoir de chaque haïtien et particulièrement de ceux qui maîtrisent le français de contribuer à ce que le français soit approprié par tous les Haïtiens et ne soit pas utilisé comme une langue d’élite. Démocratisons le français (le rendre accessible à tout le monde) et valorisons le créole : deux éléments majeurs de notre identité et mémoire collectives

LN : quels bénéfices pensez- vous tirer de ce FJAF2016 ?

WD : Ce forum peut m’apporter des outils nécessaires pour continuer mon engagement citoyen en faveur d’une Haïti meilleure. Les expériences de chacun des 50 délégués des 20 autres pays devront renforcer mes forces et mes capacités à apporter le changement. L’espace francophone est également un espace diversifie. Les pays francophones parlent tous différentes langues en plus du français et ont tous une culture identitaire différente, ce forum devra permettre de découvrir cette diversité et participer à la promotion d’un espace francophone plus diversifié où chaque culture incluant la langue peut être valorisée. Donc, c’est aussi un espace de valorisation de la langue et de la culture haïtienne donc du créole.

Question facultative : le débat français et créole, français ou créole comme langue en Haïti renvoie à un butin de guerre, quelle est l’importance du français en Haïti d’après vous ?





Port-au-Prince, 28 juin 216

Le National du 28 juin 2016 a livré un certain nombre d’articles que nous nous faisons un devoir de reprendre dans le cadre de cette page, car ils illustrent parfaitement les sentiments que nous partageons depuis Haïti et de ce côté de l’Atlantique. L’impressionnant édito du grand écrivain Gary Victor représente une manière particulièrement subtile de gloser sur la violence qui tend à s’installer sur le pays. Des articles évoquent déjà ce que l’après 28 juin faisait craindre, c’est-à-dire le refus du Parlement (et bien sûr de plusieurs de ses membres mal élus) de répondre sur l’avenir de Jocelerme Privert, et l’incertitude entretenue sur la manière d’assurer un processus électoral serein alors que les Usa viennent d’informer de leur décision de suspendre leur aide sur ce point. Enfin, le point de vue exprimé ici sur l’inconséquence de l’État à propos de la politique linguistique ne peut que retenir notre attention.

L’insoutenable légèreté de la folie

Elle court les rues. Elle peut exploser au petit matin comme ce vendredi où des individus qu’on dit non identifiés ont ouvert le feu sur des immeubles de grandes compagnies fonctionnant dans l’aire métropolitaine.

Elle s’installe dans les rues avec agressivité même à chaque période électorale comme si elle voulait rappeler à l’ensemble des citoyens que le jeu se joue entre des initiés qui défendent des intérêts que la nation doit ignorer.

Elle s’attelle à terroriser les esprits pour qu’ils puissent soit rester éloignés des lieux de décision, soit être dans l’impossibilité de distinguer le réel du mirage, le vrai du faux.

Elle ne se préoccupe pas de cette réalité qui est celle de ce chômage aigu qui frappe une grande partie de notre population, du spectre de la famine qui erre déjà dans les rues de la cité. Au moment où la priorité devrait être d’accorder la priorité aux investissements afin de créer des emplois, la folie frappe au cœur même de notre souffrance, au cœur même de notre désespoir. Comme le citoyen Jean Éric Fouché l’a si bien souligné dans son texte : Nos Java des cavernes, dans la rubrique Tribune, il y a quelque chose qui pue dans cette folie. C’est une « java ». Même l’homme des cavernes était à la recherche du feu pour se réchauffer, du feu pour voir dans les ténèbres, du feu pour s’éloigner de l’animalité. Cette folie quelque part fait honte même à l’homme des cavernes.

Ce qui s’est passé cette fin de semaine devrait alerter tout ce qui reste de sain dans notre société. Nous savions déjà que, pour beaucoup de nos compatriotes, les intérêts particuliers passent avant l’intérêt de la nation. Maintenant cela menace d’aller plus loin. Certains sont décidés à saborder la nation, à l’assassiner économiquement, à faire exploser le chômage et la famine, bref à propulser ce pays aux heures les plus sombres de l’aventure somalienne.

Nous ne pouvons pas l’accepter. Nous ne devons pas l’accepter. Aucun secteur ne doit nous faire sombrer dans la violence, dans l’anarchie, dans l’ignorance, dans la préhistoire de l’humanité au nom d’une espèce d’ayant droit sur le pouvoir politique, un pouvoir politique réduit au comportement de ces bandes de hors-la-loi qui rançonnaient les villes du Far West et que les westerns spaghettis ont à la fois immortalisés pour notre information et surtout ridiculisés.

Plein de politiques sur la scène encore aujourd’hui refusent de mesurer leur action à l’aune du délabrement d’une société dont tous les paramètres sont au rouge. Ils ont certes souvent voyagé à l’étranger, mais nous préférons dire qu’ils ont erré en aveugle, incapables qu’ils ont été même de manifester la moindre honte face à l’état de leur patrie, une honte qui aurait pu être salvatrice. Bien au contraire. Ils adoptent la posture de ces fascistes des ténèbres pour qui l’arrêt de l’histoire, l’immobilisme dans la crasse et l’ignorance seraient du nationalisme. L’heure est certainement grave. Au lieu de la prise de conscience, on veut nous proposer l’affrontement. Au lieu de revenir à l’intelligence, on veut nous proposer la sottise armée, intolérante et meurtrière. Citoyens de l’intérieur et de la diaspora, l’instant approche où nous allons devoir faire ce choix que nous avons constamment différé en croyant constamment pouvoir tirer nos marrons du feu de cette solide tradition antinationale.

Le choix entre le suicide de notre pays et la modernité démocratique.

Gary Victor

La Commission Interaméricaine des Droits de l’Homme exhorte les parlementaires à adopter une solution viable

Selon l’avis de la CIDH, il y a une absence du pouvoir exécutif en Haïti depuis le 14 juin dernier, date de la fin du mandat du président provisoire, Jocelerme Privert. Ce vide institutionnel, d’après l’institution en question, représente une menace pour l’état de droit en Haïti dont le niveau a plutôt tendance à baisser jour après jour.

Face à cette situation d’instabilité, la commission exhorte les parlementaires haïtiens à trouver une solution viable lors de l’Assemblée nationale afin d’assurer l’équilibre des pouvoirs, le respect des principes de l’État de droit et la continuité démocratique en Haïti. Car, indique l’institution internationale, le vide qui apparaît dans l’exercice du pouvoir exécutif et l’absence actuelle d’un gouvernement démocratiquement élu vont à l’encontre de la charte démocratique américaine.

La CIDH a donc renvoyé la balle dans le camp des parlementaires qui, le mardi 28 juin, doivent se réunir en assemblée pour statuer sur le cas du chef de l’État. Une Assemblée nationale, on se le rappelle, qui devait se tenir le jour même de la fin du mandat du président provisoire et qui a été avortée à deux reprises, pour des raisons d’infirmation de quorum par certains parlementaires et d’insécurité suite aux menaces des manifestants lors de la manifestation du 21 juin dernier.

À titre de rappel, la CIDH a fait remarquer que les peuples des Amériques ont un droit à la démocratie et leur gouvernement une obligation de la promouvoir et de la défendre. Très préoccupée par le triomphe de l’État de droit, cette structure de l’Organisation des États américains (OEA) a déclaré que le véritable exercice de la démocratie représentative n’est autre que la base de l’État de droit et des régimes constitutionnels des États membres de l’Organisation des États américains (OEA).

Ce n’est pas une première, cette institution qui signale que l’absence de continuité institutionnelle ne peut que compromettre la jouissance des droits des citoyens en Haïti, a souvent l’habitude d’exprimer sa préoccupation sur les conjonctures difficiles que traverse le pays, comme c’était le cas en 2015 lors de la décision prise par la cour constitutionnelle dominicaine contre les ressortissants haïtiens notamment.

À rappeler que la CIDH est un organe de l’OEA qui travaille de manière indépendante sur le continent américain. Selon la charte de l’OEA, sa mission principale est de promouvoir aux respects des droits humains dans l’Amérique. Celle-ci agit également comme organe consultatif auprès de l’OEA en la matière. L’organisation est composée de sept membres nommés à titre personnel, sans le sentiment de représentation des pays de résidence ou d’origine.

Evens Régis

Des organisations demandent l’épuration de la liste des candidats

Il s’agit d’organisations de défense de droits de l’homme qui furent impliquées dans l’observation électorale lors du fiasco des 9 août et 25 octobre 2015 : la SOFA, le CNO, le CONHANE, la JILAP, le CARDH, la POHDH et le RNDDH.

Ces organisations de défense des droits humains, dans une lettre ouverte au CEP, croient qu’il est nécessaire de savoir si les vingt-sept (27) candidats qui ont confirmé leur présence à la présidentielle prévue pour le 9 octobre 2016, sont aptes à se porter candidats. Aussi ont-elles énuméré des critères pour que ces personnalités demeurent dans la course au Palais national.

Parmi lesquels, les signataires de cette lettre citent : « le candidat à la présidence doit être une personnalité respectueuse des lois et des principes, et placée au-dessus de tout soupçon ».

Ces conditions d’acceptabilité d’une candidature ne seraient pas négociables pour ces militants qui soutiennent que c’est sur la base de ces critères que « les électeurs auront à voter pour celui qui sera investi du pouvoir de décider du sort du pays pour les cinq (5) années à venir. » Une démarche qui vient faire obstacle à la velléité de certains politiques de briguer la présidence, également qui vient mettre de l’huile sur le feu, alors que le climat est déjà très tendu avec le bras de fer ininterrompu entre parlement et Exécutif pour le contrôle de la transition.

Si le CEP s’investit dans l’épuration de la liste des candidats, ces organismes de défense de droits humains pensent qu’il apportera une aide importante à la population haïtienne pour qu’elle fasse un choix judicieux. Dans cette optique, les défenseurs de droits humains appellent à l’application de l’article 128 du Décret électoral de 2015, au moment d’analyser les dossiers, une manière de vérifier si la remise ou non des rapports narratif et financier relatifs à la subvention électorale qui a été attribuée lors des joutes de 2015, aux partis et regroupements de partis politiques, a été faite.

Les partis disposaient, en effet, d’après cet article du décret, d’un délai de « Trente (30) jours après la publication des résultats officiels… pour faire parvenir au Conseil Électoral Provisoire (CEP) et au ministère de l’Économie et des Finances (MEF), le bilan financier détaillé, signé d’un comptable agréé, accompagné des pièces justificatives des dépenses se rapportant à ladite subvention dans le cadre des joutes électorales. Ces organismes de défense des droits humains ont également souligné dans cette correspondance au CEP que certains candidats avaient fraudé et usé de la violence pour accéder au parlement. L’élection desquels avait été remise en question par le rapport de la Commission indépendante d’évaluation et de vérification électorale.

Conséquemment, ils font remarquer que ces cas conformément au décret électoral, en son article 239 alinéa 1, doivent être remis en question et soumis à une autre analyse du BCEN afin que toute la lumière soit faite. « La chose souverainement jugée », conclut-il, ne peut être utilisée en tant que bouclier pour faire obstacle à la manifestation de la vérité.

Lionel Édouard

Le refoulement des langues officielles d’Haïti dans une grande conférence caribéenne

La 41e conférence annuelle de l’Association des études de la Caraïbe (Caribbean Studies Association) a eu lieu du 6 au 11 juin 2016 à Port-au-Prince. Elle a rassemblé au fil de 300 thématiques des universitaires « de haut calibre [venus] discuter (…) des questions relatives aux mouvements globaux caribéens, peuples, idées, culture, arts et développement durable » (Le Nouvelliste, 9 juin 2016).

Plusieurs observateurs, étonnés sinon dubitatifs, ont noté que cette conférence – à laquelle ont participé trop peu d’universitaires haïtiens travaillant en Haïti -, a donné lieu à un curieux concert d’instruments à vent au motif qu’Haïti, drapée dans sa glorieuse histoire et forgeron d’un improbable « exceptionnalisme » culturel, aurait de singulières lumières à apporter à l’ensemble de la Caraïbe au parvis convulsif du 21e siècle… Ainsi, pour Carole Boyce Davies, présidente de la Caribbean Studies Association, « nous considérons le travail universitaire et intellectuel haïtien comme la clé pour comprendre la Caraïbe tout entière, la diaspora africaine, les Amériques et le reste du monde » (Le Nouvelliste, 8 juin 2016).

Pourtant la configuration positive et constructive de la rencontre avait dès le départ été mise en perspective par Carole Boyce Davies : « Cette conférence jettera les bases d’une rencontre transdisciplinaire et translinguistique qui renforcera l’intégration intellectuelle des différentes zones linguistiques et spatiales des Caraïbes » (Le National, 2 juin 2016).

Tous ceux qui s’intéressent à la fameuse « question linguistique » en Haïti devraient se réjouir qu’une si importante conférence universitaire puisse vouloir contribuer à jeter « (…) les bases d’une rencontre transdisciplinaire et translinguistique » (« translinguistique », c’est moi qui souligne ce terme). Cette perspective se veut inclusive, mais « l’intégration intellectuelle des différentes zones linguistiques et spatiales des Caraïbes » implique, en amont, de la situer dans l’éclairage du « droit à la langue » pour modéliser les communications institutionnelles en Haïti et assurer l’efficience de la transmission et de la reproduction des savoirs.

La réalité des faits nous enseigne toutefois que si la 41e conférence annuelle de l’Association des études de la Caraïbe a été un succès « transdisciplinaire » dont on saura, si nécessaire, mesurer les retombées, elle n’a nullement été « translinguistique ». Car elle ne visait pas « l’intégration intellectuelle » des jeunes francocréolophones qui aujourd’hui effectuent des études universitaires en Haïti. Au bilan, cette grande rencontre internationale, dont la langue principale de communication était l’anglais, a laissé très peu de place aux deux langues officielles du pays comme l’a précisé la sociologue Myrlande Pierre .

Myrlande Pierre a [interpellé] l’accessibilité de la communication. Elle critique le fait que les deux langues officielles d’Haïti, le créole et le français, ont été négligées dans les diverses présentations des ateliers notamment. (…) un effort additionnel aurait dû être fait (…) pour respecter les langues officielles du pays hôte de la conférence(…). Il est donc impératif, à ses yeux, que les langues d’usage du pays soient davantage prises en compte en mettant à contribution, par exemple, tous les moyens technologiques de traduction simultanée. « Cela aurait facilité une participation plus équitable en créole et en français, car l’anglais a nettement prédominé et occupé les espaces de discussion dans le cadre de la conférence », a-t-elle déploré. » (Le Nouvelliste, 13 juin 2016)

Plusieurs enseignements peuvent être tirés des remarques pertinentes de Myrlande Pierre, sociologue, chercheuse associée au Centre de recherche en immigration, ethnicité et citoyenneté de l’Université du Québec à Montréal. En tout premier lieu, l’État haïtien, démissionnaire, n’a aucun contrôle sur l’espace des transactions linguistiques publiques au pays. Depuis la promulgation de la Constitution de 1987, il a créé une Secrétairerie d’État à l’alphabétisation dont le bilan, très maigre aux plans qualitatif, méthodologique et quantitatif, accompagne le délitement de sa mission. Récemment, l’État s’est vu imposer, dans ses marges ensablées sinon dans son dos, l’établissement d’une petite ONG dénommée Académie créole dépourvue des attributions, des provisions légales contraignantes et du pouvoir d’aménagement concomitant de nos deux langues officielles. Claustrale et aphone, cette petite ONG paraétatique n’a aucun impact mesurable sur la vie des langues en Haïti, comme d’ailleurs c’est le cas de la Faculté de linguistique appliquée de l’Université d’État qui, de 1978 à nos jours, n’a pas su conceptualiser un seul énoncé de politique linguistique nationale et encore moins produire des instruments scientifiques de modélisation en didactique du créole.

En deuxième lieu, l’État haïtien – à nier les droits linguistiques de la population - ne valorise pas les langues de communication institutionnelle au pays. Dans un pays où la souveraineté nationale s’apparente souvent aux mimiques d’un ventriloque, n’importe quelle institution, nationale ou internationale, peut organiser un colloque en Haïti et imposer l’usage de l’arabe ou du japonais comme langue principale de communication au détriment du créole et du français sans que cela ne soulève l’ombre d’un questionnement… S’il est avéré que les membres de la Caribbean Studies Association utilisent couramment l’anglais comme langue de travail dans leurs pays respectifs, il est aussi attesté que plusieurs conférenciers d’origine haïtienne de ce regroupement sont créolophones et ont une relative compétence en français. En contexte, le problème de fond est celui du respect des droits linguistiques des locuteurs vivant en Haïti ; celui aussi du respect et de l’opérationnalité des deux langues officielles d’Haïti lors d’une conférence institutionnelle ayant lieu sur le territoire national.

Mais ce problème de fond n’a pas causé d’insomnie au nouveau recteur de l’Université d’État d’Haïti, Fritz Deshommes, membre fondateur de l’Académie créole, qui, le cœur léger, « a précisé [au Nouvelliste] que l’UEH était au cœur de l’organisation de la conférence. L’UEH était la seule université haïtienne membre du comité d’organisation » (Le Nouvelliste, 13 juin 2016). L’accessibilité de la communication dans les deux langues officielles du pays n’a pas constitué une obligation pour les organisateurs de la 41e conférence annuelle de l’Association des études de la Caraïbe, jusques et y compris à l’Université d’État d’Haïti qui est une institution fondatrice de l’Académie créole.

En troisième lieu, dans l’espace des transactions linguistiques interinstitutionnelles, il est possible de mettre en œuvre un cadre réglementaire de fonctionnement linguistique guidé par les exigences du « droit à la langue », du « droit à la langue maternelle1 » et de l’« équité des droits linguistiques ». Sans perdre de vue qu’il devra être arrimé à une future loi d’aménagement de nos deux langues officielles, ce cadre réglementaire prendrait en compte les paramètres de la communication interne entre les institutions et les locuteurs participant à une même activité en donnant la priorité à l’emploi obligatoire de nos deux langues officielles ; ce cadre fixerait aussi les modalités de l’emploi des langues sœurs régionales, en particulier l’anglais et l’espagnol.

L’Université du Québec à Montréal a bien compris l’importance d’un tel cadre réglementaire lorsqu’elle a édicté sa politique linguistique interne : Article 12 : Diffusion de la recherche et de la création L’UQÀM encourage fortement les (…) professeurs et les (…) chercheurs qui communiquent leur expertise sur la scène publique, soit oralement, soit par écrit, à diffuser les résultats de leurs travaux prioritairement en français et, lorsqu’ils publient ou communiquent dans une langue autre que le français, à accompagner leur texte d’un résumé substantiel en français. L’Université offre un soutien spécifique à la diffusion du savoir en langue française. (Source : UQÀM, Secrétariat des instances –Politique linguistique)

Qu’en conclure ? Il est impératif que l’État, l’Université et la société civile s’approprient une vision rassembleuse des droits linguistiques en Haïti. Ces droits sont assortis d’obligations et de responsabilités au cœur de l’aménagement futur des deux langues officielles d’Haïti. Les obligations s’appliquent aussi à l’organisation et au fonctionnement de colloques nationaux et internationaux devant respecter les droits linguistiques des locuteurs unilingues créolophones et des locuteurs bilingues créoles/français vivant au pays. Seule l’effectivité des droits linguistiques de tous les locuteurs haïtiens peut garantir l’accessibilité de la communication dans les deux langues officielles du pays. Unificatrice, cette vision permettra de modéliser les communications institutionnelles en Haïti et d’assurer l’efficience de la transmission et de la reproduction des savoirs. C’est pour cela que les linguistes, en haute clarté, accompagnent l’État qui a l’obligation d’élaborer et de mettre en œuvre la première politique nationale d’aménagement linguistique issue de la Constitution de 1987.

Robert Berrouët-Oriol
Linguiste-terminologue

NOTES
Sur les notions de « droits linguistiques », de « droit à la langue », de « droit à la langue maternelle » et d’« équité des droits linguistiques », consulter notre livre de référence : Berrouët-Oriol, R., D., Cothière, R., Fournier, H., Saint-Fort (2011). L’aménagement linguistique en Haïti : enjeux, défis et propositions. Éditions du Cidihca et Éditions de l’Université d’État d’Haïti.

Texte lié : Robert Berrouët-Oriol (2014) : Plaidoyer pour une éthique et une culture des droits linguistiques en Haïti. Éditions du Cidihca, Montréal, et Centre œcuménique des droits humains, Port-au-Prince ; voir aussi Lyonel Trouillot : « On peut habiter le bilinguisme sans tragédie », SwissInfo.ch, 16 juin 2010.





Port-au-Prince, 27 avril 2016

Notre ami Laënnec Hurbon nous adresse ce témoignage mis en forme par Le Nouvelliste et qui porte sur le traumatisme profond engendré par la folie destructrice et la violence de la famille Duvalier. Haïti a souffert de façon indicible du fait des exactions entreprises déjà avant le 26 avril 1963, mais nous comprenons évidemment par ces témoignages pleins d’émotion et de dignité que c’est l’Homme tout entier, chair, esprit, identité, citoyen, qui peut souffrir d’une dictature sanglante prête à tout pour mettre en place et préserver son pouvoir.

Centre Oecuménique des Droits Humains <cedh@cedh-haiti.org>

Actualité Devoir de Mémoire-Haïti
Duvaliérisme, impunité : pour qu’on n’oublie pas

Sont réunis ici, en public, l’historien Pierre Buteau, l’ancien militaire François Benoît et le sociologue Laënnec Hurbon

Ils ont voulu prendre appui sur ce passé triste, barbare pour pouvoir se « projeter vers l’avenir avec courage ». Ils ont voulu que ce jour, 26 avril 1963, jour fatidique dans l’histoire de la violence politique duvaliérienne, ne soit jamais couvert des ombres de l’oubli. Et que parce que les générations actuelles doivent comprendre ce qu’était le duvaliérisme, dans son essence, dans sa terreur, Pierre Buteau, historien, croit que nous « devons pouvoir faire face à ce passé », si douloureux soit-il. « Dans l’histoire de la violence politique en Haïti, on n’a jamais connu une dimension d’une telle intensité », soutient Pierre Buteau, les yeux rougis, au cours de ce débat, organisé par la Fondation Devoir de Mémoire-Haïti, mue par la lutte contre l’oubli, contre l’amnésie…

Avec beaucoup de passion, de sensibilité, d’altruisme, Pierre Buteau a effleuré ce vingt-six avril 1963, quoiqu’il soit persuadé que cette date n’est pas unique dans l’histoire de la violence duvaliérienne en Haïti. Mais il croit que c’est à partir de ce moment que l’horreur des Duvalier, au niveau de l’exercice de la violence, a atteint « une dimension extrême ». Il parle d’ « une violence extrême », de l’exécution de toute la famille Edeline, de la « boucherie de Jérémie qui s’en suivit. François Duvalier, qui a dirigé le pays d’une main de fer, d’une main couverte de sang, a voulu coûte que coûte retrouver ceux qui ont ourdi ce complot et osé s’attaquer au véhicule qui emmena ses enfants à l’école ce jour-là.

« Quand ce n’est pas en face de leur père, on poignardait les bébés parfois dans les mains de leur mère. C’est impensable », relate Pierre Buteau, rappelant que les troupes des Duvalier, durant la campagne électorale, agressaient déjà leurs adversaires, comme pour mieux rendre compte de la violence qu’incarnait le personnage. La violence duvaliérienne, d’où ça sort ? Y a-t-il une raison à la folie ? « Aucune de ces horreurs de pouvoir dans toute l’histoire d’Haïti n’est comparable à celle des Duvalier qui était innommable », tranche-t-il. Salomon, Tonton Nord, très rétifs, eux aussi, à la défense de leur pouvoir. « On ne peut pas comprendre l’Haïti d’aujourd’hui si on ne comprend pas le duvaliérisme, dit-il. On ne peut pas comprendre le duvaliérisme si on ne comprend pas d’où ça est sorti. Parce que si Duvalier a concocté dans sa tête cette violence, il y avait des bras qui abattaient les gens. D’où sont sortis ces bras qui acceptaient d’être dirigés par un monstre et qui, eux-mêmes, se comportaient en monstres ? »

Si Pierre Buteau a parlé d’une « violence extrême », Laënnec Hurbon, professeur de sociologie des religions à la FASCH, chercheur au CNRS, parle d’ « excès de violence », c’est-à-dire que les macoutes, les sbires du régime, interviennent dans tous les éléments de la vie quotidienne, jusque dans l’imaginaire de l’individu de telle sorte « qu’il ne puisse pas exister de protestation possible contre les crimes et qu’il puisse y avoir chez ceux qui ont subi ces crimes-là, ce qu’on appelle une amnésie totale ». « La raison ne doit pas abdiquer. Il faut la lutte contre l’oubli », plaide Laënnec Hurbon, incisif, à l’Université Quisqueya, sous les yeux d’une bonne centaine de personnes, pour la plupart apparentées avec les familles assassinées à Jérémie.

Académique, méticuleux, Laënnec Hurbon parle d’une dictature dont il semble maîtriser les contours. « Le duvaliérisme, dans ses mécanismes de produire des morts sans sépulture, a produit une seconde mort sur les victimes », avance le sociologue, qui souligne que le régime, dans cette démarche, cherche à marquer obligatoirement le déni de l’identité d’être humain de la victime et en même temps, relativement, la suppression de la citoyenneté des victimes. Laënnec Hurbon croit que le « devoir de mémoire et la lutte contre l’impunité, en mettant l’accent sur la justice pour les victimes, contribueront à la réintégration de la victime dans la communauté des citoyens ».

Haïti, dans son rapport à la mémoire, a un problème particulier. « Duvalier représente un sommet dans l’histoire des crimes perpétrés par les pouvoirs politiques en Haïti, mais il faut rappeler qu’il y a dans l’histoire d’Haïti une pratique de l’impunité, de l’amnésie », selon Laënnec Hurbon. Avec moult détails et son calme habituel, il cite, exemple oblige, le procès de consolidation avec le fait étrange que deux des jugés sont devenus président de la République. Il parle aussi de l’affaire des frères Coicou exécutés. Sur ce registre, la question de la politique de l’oubli qui s’incruste dans notre histoire, le petit portrait qu’il a dépeint est pour le moins sombre. « Des présidents sont partis sous la pression populaire. Leurs biens sont confisqués. Et une fois revenus au pays, ils leur sont remis. »

« Les conséquences de l’impunité sont catastrophiques et nous vivons ces catastrophes depuis une trentaine d’années », explique Laënnec Hurbon, pour qui Fort-Dimanche, l’un des symboles forts du duvaliérisme, n’a pas été une prison mais plutôt un lieu de dégradation de la condition d’être humain, de la personne qui est conduite comme prisonnier ». Il pense qu’il n’y a pas de possibilité de réconciliation nationale tant que les faits ne sont pas reconnus. « Il faut dire la vérité sur les crimes car cela est de nature à nous empêcher de nous laisser aller aux pulsions de la vengeance. » Laënnec Hurbon, convaincu que la lutte contre l’impunité a un effet émancipateur, a plaidé pour une véritable ritualisation de la mémoire. « La mémoire abstraite n’existe pas. Il faut des cadres matériels, des repères matériels qui permettent de réintégrer les victimes dans le monde des vivants ».

Le duvaliérisme reste encore un mystère dans son amour pour le crime, pour la violence. Pierre Buteau, lui, dans sa tentative d’explication, a parodié Juan Bosch, ancien président dominicain et accessoirement intellectuel raffiné : « Psychologiquement, Duvalier est un type d’homme qu’on rencontre dans les sociétés primitives. Plus il acquiert la puissance, plus il affiche de morgue sous l’effet de celle-ci, il se transforme physiquement, jour après jour, et tend à devenir parfaitement insensible. En fin de compte, il n’est plus qu’une poupée gonflable jusqu’au moment où elle perd l’équilibre et explose. Chez de tels êtres, le pouvoir qu’ils détiennent n’a pas seulement des répercussions sur leur physique, leur âme se transforme également dans le sens d’une déshumanisation progressive pour ne plus être enfin que le siège des passions effrénées. De tels hommes sont dangereux […]. À les en croire, ils ne sont plus des êtres ordinaires, mortels et faillibles mais l’incarnation en ce monde des forces obscures qui bouleversent l’univers […]. »

François Benoît, ancien instructeur à l’académie militaire, officier et premier lieutenant, qui a quitté l’armée bien avant que les choses dégénèrent, parle d’un régime dont le moteur était le crime. « Les évènements du 26 avril n’ont pas commencé le 26. Car dès le 24 avril, tous ceux qui avaient été révoqués ce jour-là de l’armée ont été recherchés. Ceux qui ont été trouvés ont été immédiatement amenés au Fort-Dimanche et fusillés. » Dans son récit-témoignage, Benoît ne s’est pas masqué pour dire, ou tout au moins confirmer, que la répression avait commencé avant le 26 avril. Ayant vécu aux premières loges la métamorphose des militaires en des escadrons de la mort, il a admis que c’est à partir de ce moment que les macoutes ont reçu un blanc-seing pour assassiner à visage découvert tous ceux qui sont soupçonnés de s’opposer au régime.

Dans le bric-à-brac du débat, des interventions pour la plupart pleines d’émotions – comme souvent chaque fois qu’on évoque les Duvalier –, des voix se sont élevées pour rappeler la possibilité qu’il y a encore de poursuivre le régime. Comme un veilleur du temple, François Benoît, lui, n’y est pas allé par quatre chemins. « L’eau qui a permis la survie des Duvalier est encore là. On ne se reconnaît pas en tant qu’Haïtien, quelle est notre responsabilité vis-à-vis des autres ? Il faut refaire l’âme haïtienne, ce par l’instruction civique », soutient-il sous une salve d’applaudissements. Dans cette plongée toute ouverte dans les plaies commises par le duvaliérisme que les écoliers haïtiens n’étudient pas encore, personne ne perd de vue que les bourreaux circulent encore.

AUTEUR
Juno Jean Baptiste
jjeanbaptiste@lenouvelliste.com




Port-au-Prince, le 9 mars 2016

Revue de presse du Groupe C3

Dans la presse nationale

Politique/ Elections

La plate-forme « rel patriyotik dénonce un plan des parlementaires membres des partis de l’ancien régime visant à paralyser l’action du président provisoire

Le porte -parole de la plate-forme « Rel patriyotik » (cri patriotique), Dextra Fritz Gerald a accusé vendredi des parlementaires du PHTK et alliés de constituer l’élément de blocage du processus de ratification de la politique générale du premier ministre désigné Fritz Alphonse Jean. Dextra Fritz Gerald a indiqué que le refus affirmé de députés et sénateurs du parti de l’ancien régime PHTK de voter en faveur M.Fritz Jean s ‘inscrit dans le cadre d’ un plan qui viserait à faire passer le temps, dans l’espoir de le voir arriver au terme de son mandat de 120 jours, sans former un gouvernement et sans avoir pu organiser des élections. Source : ahphaiti.org

Le pays sera bientôt doté d’un nouveau gouvernement

Le gouvernement provisoire sera incessamment constitué. L’annonce a été faite par le Président de la République. Jocelerme Privert tout en affirmant que les négociations avancent bien avec les secteurs concernés. Entretemps, le conseil électoral provisoire compte enfin 9 membres. Les noms seront soumis à l’appréciation du grand public indique le chef de l’état lors d’une conférence, ce vendredi. Par ailleurs, Jocelerme Privert a réaffirmé son optimisme quant à la possibilité que Fritz Jean d’obtienne un vote favorable à la déclaration de sa politique générale. Source : metropolehaiti.com

Le Sénat ne tient toujours pas séance pour élire son président

Faute de quorum, la séance plénière, qui devait se tenir au Grand Corps pour élire un nouveau président à la tête du Sénat de la République n’a pas pu avoir lieu. Elle est reportée au mardi 8 mars. L’appel nominal a constaté seulement la présence des 13 sénateurs du groupe majoritaire. Que le successeur de Jocelerme Privert au Grand Corps ne soit pas issu du groupe majoritaire qui a raflé la Présidence et la Primature, telle est l’exigence du groupe minoritaire pour permettre la tenue de séance. Source : signalfmhaiti.com

Jovenel Moise ne participerait pas au second tour de la présidentielle

C’est la panique dans le camp du PHTK depuis la rencontre de cette formation politique avec le Président Provisoire Jocelerme Privert le 19 février dernier. Selon Jovenel Moise qui faisait le compte-rendu de cette réunion jeudi à l’émission Haïti Débat sur Scoop FM, le président Privert aurait déclaré aux représentants du Parti Haïtien Tèt Kale qu’il n’était pas au courant que Jovenel Moise était qualifié pour le second de la présidentielle. Selon le président provisoire, Jovenel Moise serait classé en 5eme position suivant les résultats dont il dispose, résultats contraires à ceux publiés par le CEP de Pierre Louis Opont. Source : scoopfmhaiti.com

Haïti-Politique : Les pièces originales de Fritz Jean attendues à la chambre basse

Le premier ministre nommé Fritz-Alphonse Jean a promis d’acheminer ses pièces originales à la chambre basse, en vue de la poursuite de l’étude de son dossier, fait savoir le premier secrétaire à la chambre des députés, Abel Descollines, joint au téléphone par AlterPresse. Une séance plénière devrait avoir lieu le jeudi 3 mars 2016 à la chambre des députés en vue de constituer une commission chargée de déterminer la recevabilité ou l’irrecevabilité des pièces du premier ministre nommé. Source : alterpresse.org

Des organismes féminins rejettent l’auto désignation de Marie Frantz Joachim au CEP

Plusieurs organismes féminins (OFAVMA, COFEDNO, REFKAD, Association nationale des femmes victimes coopératives, etc.) se sont réunis, vendredi 4 mars, pour alerter l’opinion nationale et internationale sur le choix anti-démocratique de la coordonnatrice de solidarité Fanm Ayisyen (SOFA), Marie Frantz Joachim comme représentante du secteur féminin au sein du conseil électoral provisoire (CEP). Source : hpnhaiti.com

Société

Haïti-Cartographie : La Carte géographique d’Haïti doit être bientôt modifiée A cause de la précision des nouvelles données géo-spatiales que l’étude sur la cartographie a permis à l’État haïtien de disposer, le contenu de la Carte géographique d’Haïti doit être et sera modifié, a indiqué Boby Emmanuel Piard, directeur du Centre National de l’Information Géo-Spatiale (CNIGS). Cette information a été communiquée lors d’un atelier de travail tenu à l’initiative du ministère de l’Intérieur et des Collectivités territoriales (MICT), dans le cadre du Projet de reconstruction et de gestion des risques et des désastres (PRGRD), autour du thème : « Compréhension des risques naturels à travers les Nouvelles technologies de l’information et de la communication ». Source : hpnhaiti.com

Haïti- Politique : Le président provisoire, Jocelerme Privert annonce des dispositions pour renforcer la sécurité

Un ensemble de dispositions a été adopté en vue de lutter contre la remontée du banditisme et garantir la sécurité dans le pays, indique le président provisoire Jocelerme Privert lors d’une conférence de presse, au palais national, ce 4 mars 2016. Ces actions viseraient à contribuer à créer des conditions maximales de sécurité en mettant hors d’état de nuire les bandits. En ce sens, il appelle la population à collaborer avec la police pour faciliter leur capture. Source : alterpresse.org

Port-au-Prince croule sous le poids des immondices

Depuis tantôt deux semaines, la région métropolitaine de Port-au-Prince est devenue un véritable dépotoir avec des tonnes d’immondices remarquées à chaque coin de rue. Au niveau du Boulevard Jean Jacques Dessalines communément appelé Grand Rue, la circulation automobile est devenue plus difficile en raison de la présence de montagnes d’immondices jonchant la chaussée. La commune Pétion-Ville considérée comme une zone huppée avec ses grands magasins n’est pas exempte. Non loin du marché, les immondices règnent en maître. Source : infohaiti.net

Culture

Éric Charles a rassemblé le monde culturel derrière lui

La plate-forme « Mardi alternative » et Radio Galaxie se font complices pour rendre un hommage mérité au chanteur Éric Charles, décédé le 25 février dernier des suites d’un ACV. Une soirée émouvante, empreinte de solidarité en dépit d’une météo peu clémente, a été organisée à sa mémoire. Source : radiotelevisioncaraibes.com

Sport

Haïti-Foot-U17 : Les Haïtiennes en tête de classement

Après avoir battu en amical (1-0) la Costa-Rica, la sélection haïtienne très convaincante a dominé (13-0) le pays hôte la Grenade, mercredi soir à Cricket National Stadium lors de la 1ère journée du groupe A dans le cadre de la dernière phase des éliminatoires de la coupe du monde Jordanie 2016. Source : radiotelevisoncaraibes.com

Dans la presse internationale

L’ONU appelle Haïti à agir contre la surpopulation carcérale et les détentions provisoires prolongées

Malgré les avancées importantes d’Haïti en matière de protection des droits de l’Homme, un nouveau rapport de l’ONU, publié vendredi, met en lumière les manquements du système judiciaire du pays, l’usage illégal de la force par des agents de l’État, ainsi que la situation humanitaire préoccupante des milliers de personnes d’origine haïtienne déportées en Haïti par la République dominicaine. Publié par le Haut-Commissariat de l’ONU aux droits de l’Homme (HCDH), ce rapport annuel analyse la situation des droits de l’Homme en Haïti entre juillet 2014 et juin 2015. Il met en évidence des avancées en matière de droits de l’Homme, s’agissant notamment de la protection des enfants contre le trafic, la prostitution et la pornographie. Source : french.xinhuanet.com



Ils ont dit

Le sénateur Edwin Zenny, membre du bloc minoritaire : « Le président Privert est en train de commettre la même erreur que son prédécesseur Michel Martelly qui avait échoué dans ses tentatives d’imposer le juriste Bernard Gousse comme chef de gouvernement. » Source : ahphaiti.org

Le Président de la République, Jocelerme Privert : « Les discussions vont bon train avec les parlementaires et il y a de l’espoir. » Source : metropolehaiti.com

Le chef de file du groupe minoritaire au Sénat de la République, Yourie Latortue : « Le Président Privert n’a d’autre choix que de nommer un autre Premier Ministre. Un gouvernement qui n’est pas issu d’un consensus mènera inévitablement le pays vers le chaos et le trouble avec des élections qui seront à coup sûr orientées”. Source : infohaiti.net

Le linguiste Lemète Zéphyr : « La mise en place d’une commission de vérification électorale s’avère « fondamentale » dans la conjoncture actuelle. C’est la première chose à faire après l’installation du gouvernement » Source : alterpresse.org

Amnesty International, Human Rights Watch, la FIDH et Avocats sans frontières Canada (ASFC) : « La crise politique que traverse actuellement Haïti ne doit pas servir de prétexte pour priver de justice les victimes de violations des droits humains commises sous le régime de Jean-Claude Duvalier. » Source : rfmhaiti.com


Le texte de la semaine


Démocratie, gouvernance et réforme universitaire : l’expérience haïtienne

Par Fritz Deshommes*

dimanche 28 février 2016
Source : alterpresse.org

La communauté universitaire constitue l’un des secteurs les plus concernés par les transitions démocratiques. Souvent l’Université se situe à la pointe des revendications et des actions pour le changement de régime politique et demeure parmi les plus proactifs dans la période post-ancien régime. L’Université haïtienne n’y échappe pas. [1] Le présent texte part de la chute de la dictature des Duvalier et relate l’expérience de l’Université d’État d’Haïti, le plus important établissement d’enseignement supérieur d’Haïti. Il met surtout l’accent sur les écueils à éviter dans la mise en place de la démocratie universitaire et rend compte des tentatives de correction de certaines dérives constatées 30 ans après.

1- A la chute de la dictature des Duvalier en février 1986, les revendications fusent de toutes parts. Le leitmotiv à l’époque : « Changer l’État ». Sortir de l’État prédateur, patrimonial, autoritaire, centralisateur et instaurer une gouvernance démocratique, participative, décentralisée et efficace. Changer l’État, le transformer et le mettre véritablement au service de la nation.

2- Pour l’Université d’État d’Haïti, la nouvelle situation se traduit par des changements majeurs dans la composition et le fonctionnement de ses organes dirigeants et les relations avec les Pouvoirs Publics. L’élection des dirigeants à tous les niveaux, la participation des composantes fondamentales de la communauté a la gestion de l’institution (étudiants, professeurs, notamment), l’introduction de nouveaux rapports avec l’État, la dynamisation de l’Administration Centrale de l’UEH, la redéfinition de la mission de l’institution constituent autant de jalons marques sur le chemin d’une université en quête d’un fonctionnement plus efficace et plus en rapport avec sa nature.

3- Trente ans après, le bilan de ce nouveau régime fait apparaitre des points forts et des points faibles.

D’un côté, l’université devient plus capable de jouer son rôle naturel dans la société dans la formation de cadres et de dirigeants dans la production de savoirs, le développement d’une pensée critique, l’animation de la vie intellectuelle et scientifique. La nouvelle Constitution affirme son autonomie et confirme son statut d’institution indépendante. Désormais ses professeurs, dirigeants et cadres ne sont plus nommés par le Président de la République. Les Dispositions Transitoires relatives à l’organisation et au fonctionnement de l’Administration Centrale de l’UEH lui reconnaissent notamment la liberté d’expression, la liberté académique, la liberté de gestion, la liberté financière et l’inviolabilité de son espace.

D’un autre côté, le mode de mise en œuvre de ces acquis démocratiques dans un contexte d’approfondissement de la crise nationale au triple niveau politique, économique et social met en lumière les lacunes suivantes :

Mauvaise qualité des relations avec les pouvoirs publics ;
Le système est fermé sur lui-même, sans beaucoup d’interactions avec les secteurs vitaux de la société et de l’État ;

Le mode de désignation des dirigeants ne garantit que les meilleurs seront choisis ;
Le système fait montre d’un déficit flagrant d’organes de gouvernance et de régulation ;

L’organe suprême de l’institution, le Conseil de l’Université comporte de graves lacunes nuisibles à son fonctionnement harmonieux et à son développement. Citons notamment : sa composition, entre les incompatibilités des fonctions de ses membres et son caractère ferme, tourne sur lui-même ; sa nature et ses attributions réelles qui font qu’elle joue à la fois le rôle de Conseil d’Administration, de Conseil Académique, de Conseil d’Arbitrage, de Conseil Consultatif, etc. ; L’excès de démocratisme qui : a) conduit à élire au sein d’un Conseil Exécutif ou du Conseil Décanal des dirigeants sur des programmes séparés de telle sorte que l’entente devient très difficile au moment de la mise en œuvre ; b) dote les étudiants d’un poids excessif que le clientélisme des uns, la précarité des autres transformeront en une force de pression susceptible d’être préjudiciable au bon fonctionnement du système.

4- Pour pallier ces difficultés, la Commission de Réforme créée par les Dispositions Transitoires susmentionnées a fait les propositions suivantes :

Augmentation du nombre d’organes de gouvernance et de régulation à l’UEH et clarification de leur mission ;
Création d’un Conseil d’Administration, d’un Conseil Académique et Scientifique, d’un bureau du Protecteur Universitaire, d’un bureau d’Audit Interne ;
Révision de la composition de l’organe suprême dans la perspective de l’élimination des incompatibilités de fonctions occupées par la même personne ;
Option claire pour l’établissement de nouvelles relations avec les Pouvoirs Publics qui sont désormais représentes au Conseil d’Administration au triple niveau du Pouvoir Exécutif, du Pouvoir Législatif et des Collectivités Territoriales ;
Ouverture vers la Société Civile qui dispose de représentants au Conseil d’administration a travers ses Associations Professionnelles et Civiques ; Introduction de nouvelles modalités de désignation des dirigeants dans la perspective de favoriser l’émergence des candidats les plus capables, dans un cadre de gouvernance rationnelle et de sauvegarde des acquis démocratiques. Dans cette perspective, l’élection est précédée d’un processus de screening. De même, il reviendra au Recteur, au Chancelier et au Doyen de désigner leurs collaborateurs les plus directs (comme vice-recteurs, vice-chanceliers et vice-doyens), histoire de promouvoir l’unité de commandement, de vue et d’action au sein des Conseils a attributions exécutives ;
Intégration pleine et entière des entités de province au système de l’UEH. Désormais elles ont le même statut, le même mode de fonctionnement et de gouvernance que les autres entités de la capitale. Ils sont également représentés au Conseil d ’Administration. En outre, ils sont dotés d’un Conseil Consultatif local regroupant la société civile et les pouvoirs locaux.

Désormais, l’UEH est constituée d’un réseau de campus, décentralisés, dotés d’une large autonomie, lesquels mutualisent leurs ressources et leurs capacités. Ce réseau fonctionnerait sous le contrôle d’un Conseil d’Administration compose de représentants de tous les campus, à côté de ceux de l’État, des Collectivités Territoriales et de la société civile. Bien entendu, la proposition de la Commission de Réforme peut être améliorée en prévoyant une représentation appropriée du personnel administratif ainsi qu’une majorité de sièges en faveur des membres en provenance des structures internes de l’Université, dont les professeurs, les étudiants, les membres de direction et le personnel administratif. On peut même prévoir que les membres externes doivent nécessairement être des anciens de l’UEH.

5-Comme on peut s’en rendre compte, la Commission de Réforme s’est gardée de trop se prononcer sur les aspects académiques. Ils sont plus compliqués, demandent plus d’enquêtes, plus d’études, plus de temps. En outre, ils requièrent de sérieuses négociations avec les entités composant l’UEH.

Par exemple, doit-on encore consacrer la proximité thématique Droit et Sciences Économiques, dont se prévaut la Faculté du même nom ? Ne serait-il pas plus approprié de placer le Département d’Économie à côté de ceux de Comptabilité et de Gestion des Affaires logés à l’INAGHEI ? Existe-t-il des raisons majeures pour que deux Facultés différentes développent des programmes de licence en Psychologie et en Sociologie, comme c’est le cas à la FASCH et à la FE ou de sciences politiques comme c’est le cas à l’IERAH et à l’INAGHEI ? Le Décret de 1985 créant une vaste Faculté des Sciences humaines et sociales regroupant la FASCH, la FLA, la FE est-il encore d’actualité ?

Comment apprécier les propositions selon lesquelles l’ENS devrait se transformer en une vraie Faculté des Sciences de l’Éducation capable de conduire de sérieuses réflexions sur le système éducatif national et de former les enseignants à tous les niveaux, de la maternelle à l’Université, en passant par le fondamental et le secondaire ? Quand on se rappelle l’état lamentable de notre système éducatif, ses lacunes criantes en termes de disponibilités de maitres, de professeurs et de gestionnaires qualifiés, de matériel didactique et pédagogique, il est opportun de se demander si l’UEH ne serait pas plus utile à la nation si elle pouvait disposer d’une faculté appelée à devenir la référence nationale sur toutes ces questions.

L’UEH ne devrait-elle pas s’évertuer à renforcer et à valoriser les immenses capacités nationales en matière artistique et culturelle. La musique, la peinture, l’artisanat, les arts, les chants et danses demeurent des domaines trop négligés et pour lesquels notre pays dispose d’un avantage comparatif certain. On pourrait dire autant de l’Histoire, des savoirs locaux en matière de médecine traditionnelle, d’agriculture, de construction, de gestion de l’environnement, de météorologie, etc. ?

Ne devrions-nous pas créer une véritable faculté des sciences. Et par la même occasion établir la différence entre une faculté des sciences et une faculté de génie ?

Avons-nous un nombre trop élevé de facultés ? Des regroupements seraient-ils nécessaires ?

Bien entendu la plupart des propositions de la Commission de Réforme risquent de faire l’objet de fortes résistances au sein de la Communauté universitaire. Aujourd’hui en 2014, comment faire prendre conscience des lacunes, des déficits, des erreurs, des contradictions ? Comment convaincre de la nécessité d’apporter des corrections appropriées ? Comment amener à comprendre que ce qui peut paraitre comme une perte de pouvoir pour certains secteurs constituent plutôt une occasion de renforcement de l’institution et par ainsi de ces mêmes secteurs ? Comment amener le Conseil de l’Université à faire siennes ces réformes ? Dans cette conjoncture de crise multiforme, comment alerter la communauté universitaire sans dévoyer la démocratie ? Comment prendre à témoin la société civile et l’État sans mettre en danger l’autonomie universitaire ? Comment porter le reste de la société à prendre ses responsabilités vis-à-vis de sa plus grande université, financée essentiellement par les taxes et impôts des citoyens ?

* Vice-recteur à la recherche de l’Université d’État d’Haïti




Le choix du président provisoire, le sénateur Jocelerme Privert, résoudra-t-il une partie des problèmes du pays et de son personnel politique, ou sera-t-il finalement le moyen suffisant, faute de mieux, pour s’organiser vers la véritable démocratie réclamée par la plus grande partie du peuple ? Voici déjà la revue de presse et le billet d’humeur qui ont précédé la décision des parlementaires.

Port-au-Prince, le 13 février 2016

Dans la presse nationale

Politique/ Elections

Wesner Polycarpe justifie le processus pour l’élection d’un président

Les personnalités politiques intéressées par la présidence provisoire attendent le dernier jour pour soumettre leurs dossiers. Seuls trois dirigeants de partis politiques, inconnus du grand public, ont rempli les formalités de la commission bicamérale spéciale. Le président de la commission, Wesner Polycarpe, a justifié la poursuite du processus en estimant qu’il bénéficie de l’appui d’un secteur de l’Opposition. Il se dit prêt à expliquer aux manifestants l’importance du processus d’élection d’un président provisoire. Il n’est jamais trop tard pour fournir des précisions sur le bien-fondé de la démarche du Parlement, dit-il. Source : metropolehaiti.com

Faible affluence à l’inscription des candidats à la Présidence provisoire

De plus en plus de voix s’élèvent au Parlement et ailleurs contre l’éventualité que l’Assemblée Nationale soit juge et partie en tentant d’élire un parlementaire à la présidence provisoire. Des organisations politiques et le G-8 manifestent à partir de ce vendredi 12 février 2016 contre l’accord du 5 février et contre l’élection d’un parlementaire à la présidence provisoire. Source : radiokiskeya.com

Les responsables du secteur populaire et du MONOP apportent leur soutien à Jocelerme Privert comme président provisoire

Selon Roody Pierre Paul et André Fadot, M. Privert est à même de répondre aux desiderata de la population. Ils annoncent trois journées de manifestation, demain, samedi et dimanche pour forcer les présidents des deux branches du Parlement d’assumer leurs responsabilités en dotant le pays d’un président provisoire dans le meilleur délai. Source : radiotelevision2000.com

Les syndicalistes accordent un délai de 24 heures aux parlementaires

En conférence de presse, jeudi 11 février, à l’hôtel Le Plaza, des syndicalistes, fixant leur position sur la crise que connaît le pays, expriment leur désaccord au procédé des parlementaires en vue d’élire un président provisoire dans le pays. Ils disent ne pas comprendre l’attitude du Parlement haïtien dans cette aventure inconstitutionnelle d’inscription de candidats à la présidence pour la transition, a constaté Haiti Press Network. Montès Joseph, Méhu Changeux et Hary Antony, responsables du Regroupement du secteur syndical haïtien, concentrant le Front national des syndicats haïtiens (FNSH), le Secteur transporteur terrestre haïtien (STTH) et la Coalition nationale des transporteurs haïtiens (CNSTH) demandent aux parlementaires de revenir sur terre et prendre le chemin d’un consensus politique large. Source : radiotelevisioncaraibes.com

3 personnes se sont déjà fait inscrire au poste de président provisoire de la République

Parmi elles figurent, Mackenson Cangé et Jean Fritz Duvernat, a indiqué le président de la commission bicamérale spéciale, le sénateur Wetsner Polycarpe précisant que les postulants n’ont pas encore versé la quittance de 500.000 gourdes à la DGI. Source : radiotelevision2000.com

Le Forum Économique satisfait de l’accord signé entre Martelly et le Parlement

Si certains secteurs dénoncent cet accord trouvé le 6 février dernier entre Michel Martelly et les parlementaires, le Forum Économique du secteur privé, à travers une note, se montre heureux de constater la signature de cet accord de sortie de crise. « Le Forum est aussi heureux de constater une nette amélioration du climat sociopolitique enregistré depuis la signature de cet accord et la tenue de l’Assemblée nationale. Ceci augure indubitablement des lendemains meilleurs pour notre chère Haïti », lit-on dans la note. Source : signalfmhaiti.com

Arnel Bélizaire veut prendre d’assaut le Palais national avec cent-vingt hommes

L’ancien député, Arnel Bélizaire, lors d’une conférence de presse tenue mercredi 10 février, attend 120 hommes de courage et de bonne volonté pour s’accaparer du Palais national. L’ancien parlementaire n’a pas ménagé ses mots pour fustiger les sénateurs et les députés de la 50e législature qui, dit-il, prennent des décisions contre un lendemain meilleur de la population. Dans la même veine, Arnel Beliaire lance deux (2) journées de mobilisation populaire les 11 et 12 février 2016, pour dénoncer, dit-il, un coup d’État parlementaire. Source : scoopfmhaiti.com

Société

Des anciens boursiers haïtiens du Japon s’engagent à servir la communauté

Dans le cadre du transfert de connaissances entre les bousiers du Japon en Haïti en vue de promouvoir l’éducation sanitaire dans les écoles, ainsi que le management et le leadership en soins infirmiers, l’Association des ex-boursiers haïtiens du Japon (ABHJA) a organisé le week-end écoulé un atelier de formation sur la question sanitaire en Haïti. L’objectif est de contribuer à faire du droit de la santé une réalité en Haïti, et aussi créer une dynamique convergente entre les producteurs de la connaissance scientifique, les utilisateurs et les bénéficiaires. Source : lenouvelliste.com

Haïti-RD : Premier anniversaire de l’assassinat par pendaison de l’Haïtien Jean Claude Jean Harry à Santiago

Cela fait un an que Jean-Claude Jean Harry, un cireur de chaussures haïtien, a été retrouvé pendu, le 11 février 2015, sur une place publique à Santiago en République Dominicaine. Plusieurs organisations nationales et internationales ont été révoltées par cet assassinat résultant, selon elles, du racisme et de la vague de rapatriements massifs effectués par les autorités dominicaines contre les ressortissants haïtiens en territoire voisin. Ce crime, qui n’a toujours pas été éclairci par la justice dominicaine, a eu lieu dans un contexte où un processus de régularisation de migrants haïtiens en territoire voisin était en cours. Source : alterpresse.org

Coopération internationale

Le chef de la Délégation de l’Union Européenne en Haïti, Vincent Degert, a effectué une visite de courtoisie ce jeudi à la Chambre des députés

Il s’est entretenu avec son président Cholzer Chancy autour de la crise. Les deux hommes ont également abordé le dossier relatif à l’aide de l’UE en Haiti. M. Chancy affirme, par ailleurs, que certains députés et sénateurs ne seraient pas favorables à la candidature de parlementaires au poste de président provisoire. Source : radiotelevision2000.com

Education

UEH-Protestations : Des étudiants en guerre contre le Rectorat de l’université d’État
br> Des étudiants se réclamant de l’université d’État d’Haïti (UEH) ont pris pour cible l’immeuble du Rectorat de l’université d’État en semant la panique lors d’un mouvement de protestation le jeudi 11 février 2016, pour exiger, entre autres revendications, la démission du conseil d’administration dirigeant l’université d’État, a constaté Haïti Press Network. Jets de pierre, tessons de bouteille, tableaux d’affichages déchirés, pare-brise de deux véhicules cassés dans la cour intérieure, pneus enflammés au niveau des rues du Canapé vert et Rivière, le bâtiment du rectorat de l’UEH qui offre l’image d’une institution abandonnée est pourtant occupé de force, depuis 8 jours, par un groupe d’étudiants de l’Université d’État d’Haïti. Source : hpnhaiti.com

Le MENFP dénonce l’agression contre ses employés

Le ministère de l’Education nationale et de la Formation professionnelle (MENFP) condamne l’attaque à coups de pierre contre le siège central du ministère perpétrée le vendredi 5 février 2016 par des individus s’identifiant comme des directeurs d’écoles privées faisant partie du PSUGO. Selon un communiqué du ministère, cette agression gratuite a failli coûter la vie à une employée du MENFP qui a reçu des jets de pierre presqu’en plein visage. Elle a dû être transportée d’urgence à l’hôpital en vue de recevoir les premiers soins. De plus, les vitres de plusieurs véhicules ont été brisées, sans compter le traumatisme causé chez les employés par de tels actes. En tout état de cause, le MENFP estime inacceptable ce genre d’agressions physiques par certains individus se réclamant du monde de l’éducation. Source ; metropolehaiti.com

Santé

Rebondissement du choléra

6 personnes sont mortes de choléra, jeudi, à Molar, 5eme section communale de Borgne, selon le vice-délégué de l’arrondissement de Borgne/Port Margot Francisque Fortuné. Ce net rebondissement du choléra est intervenu suite aux pluies diluviennes qui se sont abattues sur la région Nord. Source : radiotelevision2000.com

Epidémie de Zika : déjà 329 cas en Haïti

La direction d’épidémiologie de laboratoire et de recherche (DELR) du ministère de la Santé publique a annoncé que le nombre de victimes de l’épidémie de Zika a considérablement augmenté en Haïti. Du 24 au 30 janvier 2016, 204 malades ont été recensés, dont 42% d’hommes et 52% de femmes. Dans le département de l’Ouest 56 cas, dont 31 à Pétion-ville, ont été détectés soit 27,45%, 53 dans l’Artibonite soit 25,98% dont 42 seulement à Verrettes et 32 infectés dans le centre soit 15,69%, tous se trouvant dans la ville de Mirebalais. La DELR a souligné que depuis la confirmation de l’épidémie Zika en Haïti, 329 personnes dans tout le pays ont contracté le Virus. Source : signalfmhaiti.com

Culture

Haïti-Carnaval : 175 personnes blessées, aucun décès, selon la Police

175 personnes ont été victimes de blessures plus ou moins légères durant les festivités carnavalesques qui se sont tenues les lundi 8 et mardi 9 février 2016, selon un bilan communiqué par la police sur sa page Facebook consultée par l’agence en ligne AlterPresse. Aucune perte en vie humaine n’a été enregistrée. Durant les deux jours, la Pnh a dénombré respectivement 47 et 128 victimes par balle, à l’arme blanche et au bâton. Source : alterpresse.org

Dans la presse internationale

La crisis de Haití incide en la migración hacia República Dominicana

De agudizarse la crisis política y aumentar la violencia en Haití tras la salida de la presidencia de Michel Martelly, decenas de nacionales de ese Estado podrían cruzar la frontera en busca de refugio en la República Dominicana. El sociólogo Wilfredo Lozana explicó que si el conflicto se prolonga mucho, algún efecto tendrá en la dinámica comercial inter y trans fronteriza, y podría estimular el aumento del flujo migratorio de grupos poblacionales vulnerables y temerosos de la violencia hacia la RD. Dijo que las autoridades dominicanas deben, como lo están haciendo, fortalecer su vigilancia de la región fronteriza, pero “sin agitación ni alharaca”. Source : diariolibre.com

René Depestre : « La situation en Haïti est carnavalesque »

Le poète, essayiste et romancier d’origine haïtienne René Depestre nous a reçus à l’occasion de son grand retour en librairie. L’auteur de Hadriana dans tous mes rêves (Gallimard, Folio), prix Renaudot 1988, publie un nouveau roman, Popa Singer (éd. Zulma), en hommage à sa mère. Un événement dans « son vieil âge d’homme », comme il qualifie joliment ses presque 90 ans. Depuis son exil qu’il n’a jamais vécu comme tel, tant son pays vibre dans son œuvre, il évoque la situation politique en Haïti, marquée aujourd’hui par une « crise de la société civile ». En cette période de carnaval, c’est ce mot même qui qualifie le mieux la vie politique haïtienne. « Je me considère comme un vaincu total en ce qui concerne Haïti. » Source : lepoint.fr

Haiti Transitional President to Be Elected Feb. 14

The Haitian National Assembly will elect a transitional president on Sunday, exactly one week after former President Michel Martelly officially stepped down from office, local legislative sources announced Wednesday. Political leaders who aspire to become presidents have until Thursday afternoon to register their candidates, the Spanish news agency EFE said. Source : telesurtv.net

Ils ont dit

Sénateur Wesner Polycarpe, président de la commission bicamérale spéciale : « Les consultations avec les divers acteurs politiques et les leaders de la société civile se poursuivent durant le processus électoral. Nous sommes à la recherche d’un consensus entre les acteurs politiques, les organisations populaires et les organisations de la société civile mais nous n’avons pas la prétention de trouver un consensus total. » Source : metropolehaiti.com

Le Sénateur Steven Benoit annonce avoir déserté le parlement pour ne pas avoir à voter dans les conditions actuelles. Il appelle ses pairs à : « ne pas se substituer à l’Exécutif et surtout à ne pas contraindre le pays à faire marche-arrière avec des élections au second degré. » Source : radiokiskeya.com

Assad Volcy, coordonnateur adjoint de la plateforme Pitit Desalin : « L’heure est à la recherche d’une large concertation. Toute solution qui ne reposerait pas sur de nouvelles négociations est vouée à l’échec : « Pitit Desalin » ne fera pas partie d’un gouvernement de transition. » Source : lenational.ht

L’ancien député, Arnel Bélizaire, lors d’une conférence de presse tenue mercredi 10 février : « Aujourd’hui, s’il existe des hommes de ma trempe, je prendrai d’assaut le Palais national. Le palais national ne peut pas rester vide aussi longtemps ». Source : scoopfmhaiti.com

Texte du jour

Les leaders, loin derrière le peuple

Par Robert Benodin

11 février 2016

On est en train d’assister au combat intense d’un peuple appauvri et exploité qui exige avec fracas le respect de sa dignité, de sa souveraineté et de son droit à l’autodétermination. Il est en train de se battre contre les forces rétrogrades des puissances hégémoniques, ces instances et ces proxys qui gouvernent son pays. Dans un premier temps, il vient paradoxalement d’infliger à ces forces rétrogrades une humiliation qui n’est pas des moindres. Malgré le fait que les puissances hégémoniques ont protégé du bec et des ongles le quinquennat de leur proxy, catapulté au pouvoir par leurs entremises. Ce peuple a pu empêcher que les résultats des deux élections irréfutablement frauduleux puissent catapulter une fois de trop au pouvoir un autre proxy. Ce peuple a refusé à Michel Martelly le proxy de ces puissances hégémoniques, l’honneur d’introniser son successeur. Une humiliation inédite dans l’histoire électorale récente d’Haïti.

Confronté maintenant à une situation d’exception, ce peuple doit, dans un second temps, se battre avec autant d’ardeur que possible pour empêcher que ces forces rétrogrades et répressives ne reprennent les rênes du pouvoir et le contrôle de la situation d’exception. De fait, il y va de son émancipation de ce continuum qui l’a mis et le retient jusqu’à présent dans cet état de pauvreté et de misère dans lequel il gît. Puisqu’on a déjà, de manière rocambolesque, validé les pouvoirs de ces parlementaires mal-élus en Assemblée Nationale. Ces mal-élus se sont déjà engagés dans un accord avec Michel Martelly pour établir le type de gouvernement de transition, son mandat, sa mission et usurper le rôle de grand-électeur ayant l’exclusivité du droit d’élire son prochain président. Élire un président provisoire (sic).

Toute reprise du second tour des présidentielles, même après une réévaluation des résultats des élections du 25 octobre, qui ne sera qu’un tri, expose aux risques d’entérinement partiel ou total des forfaits commis intentionnellement au cours de ces deux élections du 9 août et du 25 octobre 2015 et de leurs conséquences. L’annulation de ces élections est le seul moyen certain qui soit capable de réduire au minimum presque toutes les chances de noyautage par l’Internationale et par cette caste qui peut enrayer toute tentative de récupération de souveraineté et du droit à l’autodétermination.

Alors que la contestation électorale exige clairement l’annulation des élections du 9 août et du 25 octobre 2015, la totalité de la chambre des députés et les deux tiers du Sénat issus précisément de ces élections contestées, considérés comme des mal-élus, ont assumé au nom de la nation de cosigner un accord avec le président sortant, Michel Martelly, le 5 février 2016, qui leur permet d’usurper l’exclusivité du droit de choisir le chef d’État du gouvernement de transition, dont le mandat sera de 120 jours, avec l’unique mission d’organiser le second tour des présidentielles avec le même système électoral vicié.

Peut-on douter du fait que cette solution venant de ces mal-élus, supportée naturellement par l’Internationale, ne fera que maintenir le pays dans la pérennisation de ce continuum au profit de ce leadership sauvage qui a confisqué et exercé le pouvoir pendant ces derniers 59 ans. Alors qu’aujourd’hui la volonté politique majoritaire est de s’émanciper de la domination de cette caste et des contraintes de ce continuum. La contestation électorale massifiée et irréversible devra redoubler d’effort et s’intensifier pour persister sans relâche à combattre ces imposteurs qui veulent agir comme s’ils avaient la légitimité nécessaire pour prendre des décisions aussi importantes au nom de la nation haïtienne tout entière, en engageant son destin. Ils ne veulent et ne font que continuer à prendre avantage d’un peuple à bout de souffle et aux abois. Ce peuple qui aujourd’hui veut rompre avec ce continuum est en train de se chercher obstinément une nouvelle voie progressiste pour améliorer son sort et aspirer à un meilleur avenir. C’est ce pourquoi il a pris les rues pour exprimer à haute et intelligible voix sa frustration et son rejet des résultats de ces deux élections frauduleuses qui ont charrié au Parlement ces mal-élus, qui l’en empêchent !

Cette solution émanant de l’accord signé entre Martelly et les présidents des deux chambres du Parlement ne permettra pas au pays à sortir de l’impasse, en créant une nouvelle dynamique parallèle au mouvement qui a forcé la nécessité d’avoir recours à un gouvernement de transition. Cette nouvelle dynamique émanant de cet accord entre Martelly et le Parlement a par compte exclu d’un revers de la main tous ceux qui directement ont œuvré pour aboutir à cette situation d’exception. Cette solution va causer plus d’affrontement entre ces mal-élus et les forces d’opposition. Parce qu’elle ne tient pas compte, circonvient et ignore intentionnellement les revendications des masses. Alors que ceux qui veulent imposer cette solution sont de fait des imposteurs, des mal-élus, issus d’élections frauduleuses, dont la contestation électorale massifiée exige précisément leur annulation et qui sont les causes directes de la nécessité d’avoir besoin aujourd’hui d’un gouvernement de transition et d’un chef d’État provisoire. Cette solution est logiquement en conflit avec la conjoncture de contestation électorale, qui est absolument insoluble, en excluant les forces contestataires. Puisque la fraude électorale est le moyen préférentiel que l’Internationale et ses proxys ont toujours utilisé pour continuer à confisquer et exercer le pouvoir en maintenant le statu quo. La contestation électorale massifiée devenue irréversible, en provoquant l’interruption du processus électoral, a causé ce vide à la présidence que ces parlementaires issus de ces élections frauduleuses contestées essaient de combler en excluant intentionnellement la pertinence de ces acteurs politiques qui ont assumé la responsabilité de la gestion de ces actions politiques, aux fins d’aboutir à cette situation d’exception. Peut-on croire que ceux qui ont fait cet effort pour arriver à cette fin vont passivement se soumettre à la volonté de ceux contre qui ils sont en train de se battre, pour s’émanciper de ce continuum ?

On vient d’assister avec stupéfaction à un scandale inédit au lendemain des élections du 25 octobre 2015. Des candidats aux postes de parlementaire sont venus sur les ondes témoigner publiquement du fait d’avoir versé des sommes importantes à des conseillers du CEP pour s’assurer du fait qu’ils seront élus aux sièges parlementaires. Ces dénonciations n’ont pas été vagues et anonymes. Ces conseillers du CEP ont été dénoncés nommément par ces candidats. Il est évident que ces sièges parlementaires ont été mis aux enchères, aux plus offrants et derniers enchérisseurs par les conseillers du CEP. Les candidats malheureux venant, après la publication des résultats électoraux, réclamer de ces conseillers du CEP le remboursement de l’argent qu’ils leur ont versé vainement. Leurs compétiteurs ayant gagné à leur place à ces élections, parce qu’ils ont surenchéri avec des offres plus alléchantes. Ce sont ces aveux publics de candidats malheureux qui ont permis de voir au grand jour et de comprendre à quel point les conseillers de ce CEP sont corrompus et l’effet négatif que cette corruption doit avoir sur les résultats de ces deux élections. Ce scandale, à lui seul, ne suffit-il pas pour questionner la validité des résultats de ces deux élections ? Ce n’est pas à tort que la contestation électorale massifiée exige formellement l’annulation des deux élections frauduleuses.

Puisque les parlementaires issus de ces élections frauduleuses ont assumé le rôle de grand-électeur pour élire le prochain président provisoire. Ayant acheté leurs cocardes de député et de sénateur, ne vont-ils pas à leur tour mettre aux enchères le poste de président provisoire, pour lequel ils ont usurpé l’exclusivité du droit d’élire ? L’opposition progressiste ne peut pas laisser cet accord fallacieux entre Martelly et des parlementaires mafieux décider de l’avenir du pays. Après 59 ans de ce leadership sauvage qui a ravagé le pays pour en faire le plus pauvre de l’hémisphère et le classer parmi les quatre pays les plus corrompus du monde, avec naturellement l’aide et la complicité de l’Internationale et de ses instances, il est temps qu’on s’émancipe de ce continuum, pour récupérer notre souveraineté nationale et exercer notre droit à l’autodétermination. A la fin du mandat du chef d’État, le dernier en date de ces gouvernements proxys issus de la fraude électorale et de l’immixtion internationale, les masses haïtiennes ont collectivement interrompu le processus électoral par une contestation irréversible, pour ne plus permettre qu’il y ait à nouveau une passation de pouvoir de proxy à proxy dans ce pays.

Les masses haïtiennes par le biais de cet effort exceptionnel, sont sur le point de mettre fin à ces pratiques mafieuses qui permettent à ce leadership sauvage de confisquer continuellement le pouvoir depuis 59 ans. Vont-elles, étant sur le point de franchir ce seuil, permettre à ces parlementaires issus de ces deux élections frauduleuses, dont elles exigent l’annulation, de faire usage d’un accord fallacieux émanant d’une entente mafieuse avec Martelly, supportée par l’Internationale, de fouler aux pieds leurs revendications et de les jeter au rancart, pour maintenir le cap au sein du continuum ?

Le moment est venu de faire cette réflexion profonde sur la refondation de l’État, la reconstruction, la restructuration de toutes les institutions sans exception et particulièrement l’institutionnalisation du système électoral. Cette opportunité s’offre aujourd’hui à ceux qui auront le courage de mener le combat progressiste jusqu’au bout contre les forces rétrogrades qui poursuivent le maintien du statu quo. L’argumentum ad populum vient irréfutablement de faire ses preuves, en interrompant de manière irréversible le processus électoral vicié, pour empêcher que la passation traditionnelle du pouvoir puisse se faire d’un proxy à un autre. Ne permettez pas à ces mal-élus de reprendre le haut du pavé, en réimposant cette tradition d’élections frauduleuses et d’immixtion internationale catapultant au pouvoir les chefs d’État de son choix ! Que Martelly soit le dernier de cette caste de chefs d’État proxys !






L’actualité va vite en ce moment. Nous savons désormais que la solution choisie par le pays pour régler le problème tend vers la constitution d’un gouvernement de transition et qu’un nouveau scrutin présidentiel sera organisé. Tout ceci a été accepté par l’ensemble des acteurs concernés, dont l’ancien président Martelly qui devrait quitter le pouvoir au jour-dit (suspense ?). Nous incluons cependant le bulletin hebdomadaire du C3GROUP, pour information fort légitime.

Port-au-Prince, 5 février 2016

Dans la presse nationale

Politique/ Elections

Haïti-Crise : Martelly lève le doute sur son départ le 7 février

Le président Michel Martelly a confirmé ce 4 février qu’il quittera son poste à la fin de son mandat le 7 février prochain. « Je ne veux pas garder le pouvoir un jour supplémentaire », a déclaré Martelly dans un discours prononcé lors de l’inauguration du nouvel immeuble du ministère de l’Intérieur, détruit lors du terrible séisme de 2010. Martelly a affirmé qu’il partait « sans regret, sans envie, sans attache », à l’issue de 5 ans passés à la tête du pays, dont 4 sans organiser d’élections, tandis que des scrutins fortement controversés et inachevés se sont déroulés au cours de la dernière année (en août et novembre 2015). Source : alterpresse.org

Les membres de l’opposition à nouveau dans les rues, ce Jeudi

Les membres de l’opposition étaient à nouveau dans les rues, ce jeudi, pour continuer d’exiger le départ du président Michel Martelly et la mise en place d’un gouvernement de transition. La manifestation a pris fin devant le Parlement. Les protestataires en ont profité pour dénoncer la tenue de la séance en assemblée nationale. Source : radiotelevision2000.com

Nouvelle manifestation des partisans de Jovenel Moïse

Pour la deuxième journée consécutive, plusieurs milliers de partisans du PHTK ont manifesté cette fois-ci dans la commune de Carrefour afin d’exiger la tenue au plus vite du second tour de la présidentielle. Les protestataires annoncent qu’ils sont contre la mise en place dans le pays d’un gouvernement de transition au départ de Michel Martelly. La manifestation s’est déroulée sans incident majeur. Parallèlement, des milliers de partisans du PHTK ont gagné les rues du Cap-Haïtien mercredi, pour exiger la tenue rapide du second tour des élections et le maintien en place du président Martelly jusqu’à ce qu’un nouveau chef de l’État soit élu. Source : metropolehaiti.com

Haïti-Parlement : la 50e législature rentre en fonction, les députés sont aux anges

La séance en Assemblée nationale s’est tenue le jeudi 4 février, soit près d’un mois après la prestation de serment et la validation du pouvoir des députés. Désormais, les travaux parlementaires peuvent démarrer à la chambre basse. 22 sénateurs et 92 députés ont répondu à l’appel, donnant lieu définitivement à l’ouverture de la séance en Assemblée nationale. Dans son discours de circonstance, le président du Sénat Jocelerme Privert a rappelé, d’entrée de jeu, que 2016 marque la 30e année de la rupture du peuple haïtien avec la dictature des Duvalier et du virage vers la démocratie. Source : hpnhaiti.com

Société

Vicky Jeudy dévoile un sein sur le tapis rouge du SAG Awards au côté de Leonardo Di Caprio

L’actrice d’origine haïtienne Vicky Jeudy a remporté son deuxième SAG Award pour sa performance avec l’équipe de la série de Netflix « Orange is the New Black » le week-end écoulé lors de la 22e édition du Screen Actors Guild Awards à Los Angeles (Californie, Etats-Unis). Au cours de son entrée sur le tapis rouge, en posant avec l’acteur Léonardo Dicaprio, la star a laissé apparaître par accident son sein droit, un moment que les photographes n’ont pas raté pour immortaliser. Source : hpnhaiti.com

Santé

Zika : l’OMS recommande de restreindre les dons de sang
br> Face au virus Zika, le monde s’organise. Et l’Organisation mondiale de la santé commence à prendre ses précautions. « Avec le risque de nouvelles infections du virus Zika dans de nombreux pays, et le lien possible entre (…) le virus et la microcéphalie et d’autres conséquences cliniques, restreindre les dons de sang de ceux revenant de régions où sévit l’épidémie de Zika, est jugé comme une mesure de précaution appropriée », a indiqué l’OMS ce jeudi. Le Canada et la Grande-Bretagne ont d’ailleurs déjà pris les devants. Source : lenational.ht

Culture

Le carnaval de 2016 aura bel et bien lieu

Le défilé traditionnel du carnaval aura lieu cette année aux Champs de mars, malgré le retard enregistré dans la construction des stands. Le responsable de communication du comité a indique qu’un budget de 45 millions de gourdes a été élaboré en prévision des festivités qui doivent se dérouler les 7, 8 et 9 février prochain. Carel Pèdre a aussi précisé qu’un nombre réduit de stands et de chars seront sur le parcours, en raison de la réticence de certains sponsors. Source : metropolehaiti.com

Haïti-Culture : L’utilisation du cinéma Triomphe à des fins politiques et non pour le cinéma, dénoncent des réalisateurs haïtiens

Le Ciné théâtre « Triomphe » serait utilisé à des fins politiques et non pour le cinéma, déplore la « Haitian American Association of Filmmakers », dans une note de presse, en date du 27 janvier 2016, transmise à l’agence en ligne AlterPresse. La Haitian American Association of Filmmakers explique qu’elle s’était portée partenaire, au Triomphe, dans la promotion et l’exploitation du cinéma haïtien, parce qu’elle croyait que ce complexe – inauguré par le président Joseph Michel Martelly – était au service de la culture haïtienne et non à des fins politiques. « Si la grande joie des cinéphiles haïtiens de la capitale de retrouver le cinéma haïtien en salle, a été interrompue, elle est due (c’est la faute de) au ministère de la culture, qui a ordonné la fermeture du Triomphe, le 4 janvier 2016, en plein contrat d’exploitation », dénonce l’association, dans cette note portant la signature de son président, Raynald Delerme. Source : hpnhaiti.com

Dans la presse internationale

EEUU pide un acuerdo de gobernabilidad en Haití antes del domingo

Estados Unidos urgió ayer a las autoridades ejecutivas y legislativas de Haití a alcanzar un acuerdo sobre cómo gobernar el país antes de que el actual presidente, Michel Martelly, abandone el poder este domingo, además de avanzar hacia la elección democrática de un nuevo mandatario. « Estados Unidos urge al Ejecutivo y el Parlamento, las autoridades constitucionales de Haití, a llegar a un acuerdo sobre una hoja de ruta para gobernar el país hasta que se elija a un nuevo presidente », dijo a Efe un portavoz del Departamento de Estado estadounidense. Source : listindiario.com

Haïti risque de ne plus avoir de président dès dimanche

La constitution haïtienne prévoit le départ de Michel Martelly de son poste de chef de l’État le 7 février mais son successeur n’ayant pas pu être élu, le pouvoir présidentiel sera de facto vacant à compter de ce dimanche matin. Haïti risque de sombrer une nouvelle fois dans un vide de pouvoir. Source : la1ere.fr

Rechazan canción del presidente de Haití en la que ataca a periodista

Decenas de personalidades y organizaciones de derechos humanos de Haití condenaron hoy la polémica canción que el presidente del país, Michel Martelly, lanzó con motivo de la celebración del carnaval, que comienza el domingo 7 de febrero, el mismo día que termina su mandato. En la canción, Martelly ataca personalmente a la periodista Liliane Pierre Paul, una de las figuras más respetadas en la prensa haitiana con más de 30 años de carrera profesional. En un comunicado conjunto, organizaciones y personalidades locales criticaron “enérgicamente” el tema, que consideran sexista y ofensivo. Source : diariolibre.com

OAS : Talks to end Haiti crisis at delicate stage

The mission from the Organisation of American States (OAS) seeking to broker an agreement to end the political and constitutional crisis in Haiti says the discussions are now at a “very delicate and urgent stage”. The mission, which arrived here last Sunday and is headed by Antigua and Barbuda diplomat Sir Ronald Sanders, is trying to broker the accord ahead of the planned February 7 departure from office of President Michel Martelly. Opposition parties forced the indefinite cancellation of the January 24 second round of balloting to choose a successor to Martelly and have been calling instead for the establishment of an interim government to oversee fresh elections in the French-speaking Caribbean Community (Caricom) country. Source : jamaicaobserver.com

Ils ont dit

Le président Michel Martelly ce 4 février : « Je ne veux pas garder le pouvoir un jour supplémentaire ». Source : alterpresse.org

Le coordonateur de Ligue Alternative pour le Progrès et l’Emancipation Haïtienne (Lapeh), Anacacis Jean Hector : « Il serait préférable que le Premier Ministre Evans Paul reste en poste après le départ du président Martelly. Le chef du gouvernement doit assumer sa charge comme l’avait fait le Premier Ministre Yvon Neptune après le départ du président Aristide en 2004. » Source : metropolehaiti.com

Me Monferrier Dorval : « Le Premier ministre actuel est quasi inopérant. Il n’a pas eu l’onction du Parlement. Le contexte « n’est pas favorable à la reconduction d’Evans Paul qui pourra présenter sa démission au président provisoire, sitôt installé dans ses fonctions. » Source : lenouvelliste.com

Texte du jour

Hommage à Liliane Pierre-Paul : 5 Février 2016 @ Karibe Convention Center
Source : radiotelevisioncaraibes.com

Bonè-bonè nan vi li, nan lane 1970 yo, Liliane Pierre-Paul te montre jan li kwè bon jan enfòmasyon se bon zanmi libète. Bon travay li nan sans sa a, pawòl li ak aksyon li, tou fèl vin pòtèz labanyè pou fanm grandèt granmoun, libète lib e libè, dwadelòm, demokrasi nèt alkole, epitou pou pi fò moun nan peyi a ke sistèm sosyal la mete akote, ki pa ka souse yon zo, kip a ka jwenn jistis devan jij. Ansanm ak 2 zanmi, Sony Bastien ak Marvel Dandin, ki sakrifye yo tou pou Ayisyen gen lwa djòl yo, san li pa mache di sa nou pral di la a, li vin yon antreprenèz, ki di donk li kwè ke chak moun gen dwa travay pou tèt yo pandan y ap respekte lwa lavi a kif è lòm pa janm viv grenn senk, se nan solidarite youn pou tout, tout pou youn la vi ka bèl. Nan koze sa a, Liliane Pierre-Paul toujou montre l pa nan tchans avèk moun k ap betize ak demokrasi a. Depi lè mou nap tande Madanm sa a, nou fin pa wè sa ki ekri kòm manman prensip nan konstitisyon an se degouden ak 50 kòb y oye avèk sa l kwè : « fò noutout fè youn, fò nou derasinen afè nèg mòn-nèg lavil, moun wouj-moun nwa, nèg sòt, nèg lespri, fò nou aksepte nou gen 2 lang ak yon kilti ki pou noutout, pou nou travay pou pwogrè, enfòmasyon, edikasyon, sante, travay, amizman pou tout sitwayen ayisyen. Liliane Pierre-Paul se tout sa yo ankè.

Nan defann tout prensip sa yo tankou Dessalines t ap defann libète nou, gran fanm sa a ki rele Liliane nan resevwa move kou : an 1986, gouvènman avi Duvalier mete l nan prizon, pimpe l annekzil ; an 2016, prezidan peyi a sal pwòch bouch pa li pou l eseye fè Liliane kriye.

Monte-desann, nad marinad, Liliane Pierre-Paul menm jan ak Penelope nan mitoloji peyi la Grèce ki te kenbe kin alaganach pou l pa reponn okenn gason pandan mari l te pati nan bato, Liliane Pierre-Paul toujou rete doubout , anyen, ni trayizon, ni move pawòl pa rive fèl bese tèt li. Doubout pou l di « li fè 4 è nan Radyo Kiskeya », epi se defans tout gwo lide li kwè kif è yon moun, doubout pou repitasyon peyi a, doubout pou lajistis, doubout pou travay leta fèt, doubout pou bèl prensip viv ansanm.

Lilianne pa bay pèp ayisyen an manti. Se kòmsi Maurice Sixto se Liliane li te gade pou l te kree pèsonaj Sandrine nan, mod fanm sa a san repròch, ki pa janm pè, ki konnen bonsans, larezone ak lajistis se bon gid lavi. Fanm pa kite pèsonn pran chans fòse l fèmen bouch li. Li gen rezon paske vwa Liliane se yon bon ti sèvyèt cho pou pwoteje ti bebe kont move zè e ki pèmèt tout moun konnen ladousè mo yo rele libète a. Liliane konnen se sa k pou fè lavi miyò. Li konnen depi l fèmen je l yon ti moman, li konnen depi l pa pale 2-3 jou, tiran yo pral crache dife lanfè sou pèp la ki ka fè moun tounen bèt, li konnen depi l pa pale 2-3 jou, ti moun pral rekòmanse pè pou fiyèt lalo pa manje yo, depi l pa pale 2-3 jou, li konnen depite pap menm ka plenyen difèt yo fè kostim yo tounen tòchon, depi li pa pale 2-3 jou li konnen etidyan pap menm ka plenyen zanzave ba yo kalòt, depi li pa pale 2-3 jou li konnen prezidan ap toujou di betiz fè betiz kòmsi lang sal ta kab sèvi kòz pèp… Sa ki dwòl la zèfè ti voryen yo se luil nan motè machin Liliane pou l defann demockrasi ak tout limanite, noumenm ki nan bon bò a nou konnen se yon devwa pou nou ede ti voryen sa yo pou yo pa tounen zannimo nèt. Nou gen devwa sa a , jan Madan Pierre-Paul fè l chak jou a, pou nous sove ti kras imanite sa a ki rete kay ti vagabon sa yo.

Tout verite sa yo se rezon ki pouse komite sitwayen sa a deside òganize yon seremoni omaj pou Liliane Pierre-Paul, yon ti ankourajman pou nou raple l pawòl li gen sans pou Ayisyen. Annavan Liliane, « li fè 4 è nan radyo Kiskeya », lè sa a se lè w pou pasyans Penelope la ak detèminasyon Sandrine nan pou toujou rekòmanse, toujou kenbe, kontinye, peze sou devwa sa a : pou nou toujou chèche pou chak jou nou vin plis moun ke jan nou moun nan, pou nou fè sa ki konprann ke bay moun kou, joure, vòlè pa kapab tounen byen. Manzè Liliane, travay pou fè Ayisyen fè pwogrè kòm imen, nan Karibe a demen vandredi 5 fevriye a, fanm kou gason ki ta renmen Ayiti sanble ak lide ou yo ap rann ou omaj ki pap janm genyen tout fòs ke entegrite w ak lanmou w pou Ayiti merite

Pou Komite sitwayen an :
Patrice Dumont : Sitwayen angaje
Yves Lafortune : MAP, Avocat (Consultations et Résultats)
Ralph Jean-Baptiste : Association Culturelle Café Philo Haïti (ACCPH)
Marie Yolène Gilles (RNDDH)






Port-au-Prince, le 18 janvier 2016

Haïti dans la presse nationale et internationale

Revue de presse C3GROUP SA

Dans la presse nationale

Politique/ Elections

Elections : L’opposition politique annonce des plaintes contre l’ingérence d’ambassadeurs étrangers dans les affaires internes d’Haïti L’opposition politique en Haïti annonce des plaintes formelles contre l’ingérence d’ambassadeurs étrangers dans les affaires internes du pays, dans une note en date du jeudi 14 janvier 2016, transmise à AlterPresse. « Au cas où ces ambassadeurs persistent dans leur ingérence, pour supporter, à leur profit, l’inacceptable et la corruption, à travers un processus électoral frauduleux, illégal et inconstitutionnel, des plaintes formelles seront portées contre eux par devant les Parlements de leurs États respectifs », soutient-elle. La note fait injonction au Core Group (qui comprend plusieurs représentants de pays dits amis d’Haïti) de respecter l’article 41-1 de la Convention de Vienne sur les relations diplomatiques du 18 avril 1961. Source ; alterpresse.org

Fanmi Lavalas salue la décision de Jude Célestin

Le parti Fanmi Lavalas dit appuyer la décision du candidat de LAPEH Jude Célestin de ne pas participer au second tour de l’élection présidentielle prévu le 24 janvier prochain. Lors d’une interview accordée à Radio Métropole ce vendredi, l’avocat du parti Me Gervais Charles a réaffirmé que le conseil électoral ne possédait plus la légitimité pour organiser de bonne élection dans le pays. Source : metropolehaiti.com

La CPH semble divisée sur le choix de Métédieu Lucien en remplacement de Vijonet Déméro

A peine désigné par la Communauté Protestante d’Haiti (CPH) pour remplacer le pasteur Vijonet Déméro au Conseil Electoral Provisoire (CEP), Métédieu Lucien n’aurait pas eu la bénédiction de Jacques N. Janvier, ce dernier qui dénonce sa signature apposée au bas de la correspondance adressée au Président de la République faisant mention de cette proposition. « Je réponds au nom de Pasteur Jacques N. Janvier, sain de corps et d’esprit… La lettre de la communauté protestante n’engage pas le Président de la Fédération des Pasteurs du Grand Nord d’Haïti. « Je n’ai signé aucun document en ce sens, on a signé pour moi… » Source : scoopfmhaiti.com

Haïti-Elections : Le Collectif décline l’invitation du CEP
br> Dans une lettre adressée à Pierre Louis Opont, président du Conseil Electoral Provisoire (CEP),le Collectif du 4 Décembre annonce son refus de participer comme observateur aux élections du dimanche 24 janvier , apprend HPN. Relatant que c’est par voie de presse qu’il a appris que le nom du Collectif figure sur la liste des organisations nationales habilitées à observer les élections, l’organisation dit décliner cette invitation. Source : hpnhaiti.com

Société

Deux nouvelles journées de manifestation

En conférence de presse ce vendredi 15 janvier 2016, la table de la mobilisation du G8 annonce la tenue de deux journées de protestation dans les rues de la capitale pour le lundi 18 et le mardi 19 janvier 2016, pour dénoncer une fois de plus les exactions du pouvoir en place dans la vassalisation des institutions prestigieuses du pays, particulièrement la justice et le parlement. La question des élections vient empirer la crise qui sévissait déjà dans le pays, ont fait savoir les représentants de cinq des huit candidats formant le G8, lors de cette conférence de presse. Source : radiotelevisioncaraibes.com

Aucune date pour la tenue de l’Assemblée nationale

Alors que la date du 11 janvier a été considérée comme une date non-négociable pour la rentrée de la 50e législature, une semaine après cette date « butoir », l’Assemblée nationale devant ouvrir officiellement l’année législative n’a toujours pas siégé. Et jusqu’ici, aucune date n’est retenue pour la tenue de cette Assemblée nationale. Source : lenational.ht

Education

Haïti-Année Gouverneurs de la rosée : Les élèves de philo s’engagent pour sa réussite

Samedi 16 janvier 2016, à l’hôtel Marriott, le ministre de l’Éducation nationale, M. Nesmy Manigat a rencontré 23 comités centraux de classe terminale, venus essentiellement de lycées dans le département de l’Ouest, ainsi que deux invités spéciaux en provenance du Sud-est (lycées Pinchinat et Célie Lamour). Une rencontre qui s’inscrit dans le cadre de « l’Année Gouverneurs de la rosée » et de la « Campagne d’éducation civique », a constaté Haiti Press Network. Source : hpnhaiti.com

Dans la presse internationale

Adriana Lima is working to help Haiti

Haiti is so poor, Brazilian beauty Adriana Lima has dedicated herself to helping out the earthquake-ravaged hellhole. Lima has visited Haiti twice in the past year, she told the crowd at the Garage on 11th Avenue, where fellow Brazilian Jayma Cardoso and designer Kenneth Cole were helping to raise money Thursday night to support a hospital there. Also on hand was Marek Paliwoda, a dermatology physician assistant who goes to Haiti three times a year to provide skin cancer screenings. Source : pagesix.com

Celestin advierte contra elecciones

El candidato opositor a la presidencia de Haití afirmó que si se lleva a cabo la segunda vuelta electoral el próximo fin de semana como está programado, será un revés para la frágil democracia del país. Jude Celestin dijo que teme que habrá fraude electoral y una gran falta de transparencia por parte de las autoridades electorales, y que por eso está boicoteando la segunda vuelta del 24 de enero en que debía competir contra el sucesor elegido por el presidente saliente. Celestin declaró a The Associated Press que Haití está “avanzando hacia una selección, no una elección”. El candidato está haciendo caso omiso de los llamados de Estados Unidos y otros países de que haya una competencia real en las elecciones que están financiando. Source : listindiario.com

Texte du jour

“Profond mépris” de la communauté internationale envers Haïti

Prise de position concernant l’attitude de la communauté internationale
Par le Groupe de la société civile et de partis politiques réclamant l’annulation des élections et des poursuites à l’encontre des responsables de fraude

Document transmis à AlterPresse le 16 janvier 2015

La communauté internationale dominée en Haïti par le Core Groupe −réunissant le Brésil, le Canada, l’Espagne, les États-Unis d’Amérique, la France, l’OÉA (Organisation des États américains) et l’Union européenne− s’est systématiquement engagée, depuis des décennies, à contrecarrer les processus nationaux visant à concrétiser les aspirations exprimées par les populations à la chute de la dictature duvaliériste, à savoir : permettre la transition qui assurerait le démantèlement des structures de pouvoir autoritaire et despotique et la construction d’un État de droit démocratique.

En particulier, le positionnement relatif au processus électoral actuel traduit le profond mépris dans lequel cette communauté internationale tient Haïti. En dépit des faits tenaces, qui prouvent le caractère incohérent et frauduleux des scrutins des 9 août et 25 octobre 2015, elle insiste, fait pression pour que ce processus vicié suive inexorablement son cours, au détriment de la dignité nationale et des principes démocratiques, afin d’imposer des résultats électoraux en tous points irrecevables. Dans son arrogance, cette communauté internationale croit que son statut de conglomérat de grandes puissances, de bailleur de fonds, lui confère tous les droits en Haïti, incluant celui de décider qui doit être aux commandes de l’État. En intervenant systématiquement et ouvertement dans les affaires internes du pays, pour conforter le gouvernement en poste dans ses dérives et justifier des manigances électorales qui, en aucun cas, ne seraient acceptables dans leurs pays, cette communauté internationale alimente continuellement les crises à répétition qui saccagent le pays. Elle empêche le peuple haïtien de réaliser son propre cheminement pour l’instauration d’un État souverain, démocratique, guidé par l’intérêt collectif.

La société civile et la société politique, qui s’associent pour exiger l’annulation des élections et des poursuites judiciaires à l’encontre des responsables de la gabegie, considèrent que la surdité et la cécité affichées par le Core Groupe est l’expression de la volonté d’imposer des choix politiques à Haïti, de la maintenir sous une occupation qui ne dit pas son nom, afin de préserver des intérêts en parfaite opposition avec les désidératas du peuple haïtien. A chaque nouvelle étape le Core group s’engage à corriger les « erreurs » de la phase antérieure, comme si celles-ci n’avaient aucune conséquence sur les élections, sur les élus, mais surtout sur la vie des Haïtiens et des Haïtiennes. Il s’enkyste par ailleurs dans une logique mercantile à prétendre justifier son attitude par les dépenses qu’il a déjà consenties. Rien ne saurait être plus léger.

• Les élections contestées ou frauduleuses, en aucune façon ne sauraient garantir la légitimité la stabilité et la gouvernabilité. Par conséquent elles auront un impact négatif sur la gouvernance économique et politique. En témoigne le maigre taux moyen de croissance de 1,5% dans lequel pataugeait notre pays entre 2000 et 2014.

Elles fragilisent les soi-disant élus en les transformant ainsi en des proies faciles entre les mains des acteurs tant nationaux qu’internationaux.

Les citoyennes et citoyens mobilisés pour le refus de l’inacceptable, n’entendent pas se plier au diktat du Core Groupe et continueront à lutter pour l’avènement d’une Haïti souveraine, solidaire, respectueuse des droits et libertés.

Signataires : : Marie Frantz JOACHIM, Edmonde S. BEAUZILE, Pierre BUTEAU, Freud JEAN, Jean Baptiste BIEN AIME, Jean William JEANTY, Junot FELIX, Wesner POLYCARPE, Jean Henold BUTEAU, Yolette Andrée JEANTY

Port-au-Prince, le 15 janvier 2016
Pour authentification

Marie-Frantz JOACHIM
Coordonnatrice générale de la SOFA

Jean-William JEANTY
Coordonnateur général du parti Kontra Pèp la






Port-au-Prince, le 8 janvier 2016

Voici la livraison du 8 janvier 2016 de la revue de presse du C3 Group. On y trouve une forme officielle de version des faits, et une note de Robert Benodin insistant de façon circonstanciée sur le rôle joué par les intérêts étrangers, et en particulier nord-américains, dans ce qui apparaît bien comme une volonté de reproduire indéfiniment un système de soumission dont ne profiterait qu’un nombre très restreint de Haïtiens.

Dans la presse nationale

Politique/ Elections

Martelly offense-t-il l’Église catholique ?

En décidant d’avancer avec le processus électoral sans tenir compte des recommandations de la Commission d’évaluation électorale, le chef de l’État offense l’Église catholique et le cardinal Chibly Langlois qui s’était impliqué personnellement dans la formation de cette structure, a déclaré au Nouvelliste une source proche de l’Église catholique. Pour sa part, Rosny Desroches, membre de la Commission, estime que Michel Martelly a commis une erreur en ce sens. Source : lenouvelliste.com

Haïti : La campagne électorale pour les scrutins du 24 janvier s’étendra du 8 au 22 janvier 2016

La campagne électorale pour le second tour des élections, prévu pour le 24 janvier 2016, s’étendra du vendredi 8 au vendredi 22 janvier 2016, a indiqué à Haïti Press Network le porte-parole du Conseil Electoral Provisoire (CEP), Roudy Stanley Penn. Il s’agit, selon le porte-parole du CEP, d’une période additionnelle puisque l’institution électorale avait déjà fixé la date de la campagne pour le second tour. Source : hpnhaiti.com

Le président Michel Martelly lance des flèches contre l’opposition qu’il accuse d’utiliser la violence pour arriver au pouvoir

Le président Michel Martelly, dans un arrêté daté du 6 janvier, a invité la population à aller voter dans le cadre du second tour de la présidentielle et des législatives complémentaires, le 24 janvier prochain. Parallèlement, dans une adresse à la nation, Michel Martelly a tenté de justifier cette décision intervenue avant même le début des recommandations de la commission d’évaluation qu’il a lui-même formée, se disant totalement contre l’idée de la mise en place d’un gouvernement de transition, une option qui, selon lui, serait désavantageuse pour la nation. Il a lancé du coup des critiques acerbes à l’encontre de l’opposition qu’il accuse de vouloir arriver au pouvoir par la violence… Source : ahphaiti.org

Youri Latortue appelle les sénateurs à préparer l’entrée en fonction des nouveaux élus

Le sénat dans sa configuration actuelle à dix membres ne dispose pas des provisions pour poser un acte parlementaire selon Youri Latortue. Le sénateur élu de l’Artibonite, appelle les sénateurs actuellement en fonction à préparer l’entrée en fonction des nouveaux élus le 11 janvier prochain avant de se préoccuper d’un éventuel vide au niveau du pouvoir exécutif le 07 février prochain. Source : metropolehaiti.com

La CEEI n’a constaté aucune trace de fraude, selon Michel Martelly

Environ trois jours après avoir reçu au palais national le rapport de la Commission d’évaluation électorale indépendante, le président de la République se prononce enfin sur ce document. De ce document, le chef de l’État ne retient qu’une chose. « Le rapport recommande la poursuite du processus électoral puisque la Commission dit n’avoir constaté aucune trace de fraudes lors des élections du 25 octobre ». Source : lenouvelliste.com

Les sénateurs ne peuvent pas bloquer l’entrée en fonction des nouveaux élus

Les sénateurs en place n’ont aucun motif pour bloquer les nouveaux élus assure pour sa part le sénateur François Anick Joseph. Il insiste toutefois sur la nécessité de respecter les règlements intérieurs du sénat qui stipulent que les nouveaux sénateurs doivent s’inscrire auprès de leur chambre 72 heures après la proclamation des résultats par le conseil électoral ce qui n’a pas été fait jusqu’ici. Par ailleurs il explique que la date et les modalités de leur entrée en fonction doivent être définies par le sénat lui-même. Source : metropolehaiti.com

Communiqué de l’OEA (Extrait)

La Mission d’observation électorale (MOE) de l’Organisation des États Américains (OEA) en Haïti salue l’établissement d’une date pour le second tour des élections présidentielles comme un « pas dans la bonne direction ». Elle appelle l’ensemble des acteurs à travailler à l’amélioration des conditions en vue du vote annoncé pour le 24 janvier. La conclusion du processus électoral permettra un transfert de pouvoir constitutionnel à un nouveau Président élu. La Mission considère comme une mesure positive la dissociation des élections locales du second tour des présidentielles limitant le nombre de mandataires dans les bureaux de vote et permettant ainsi d’éviter une répétition des problèmes survenus le 25 octobre (…). Source : alterpresse.org

Société

Le relogement des déplacés se poursuit

Le processus de relogement des déplacés et la réhabilitation des quartiers se poursuit a Port-au-Prince, 6 ans après le tremblement de terre du 12 janvier. A Fort national, Morne Lazard et dans quelques localités de la commune de Delmas des maisons d’habitations sont en cours de construction alors que d’autres ont déjà été remises à leurs nouveaux occupants. Les habitants de ces quartiers reconnaissaient l’importance de ces travaux même s’ils continuent à réclamer plus d’assistance de la part des responsables. Source : metropolehaiti.com

La liste des déportés s’amplifie

Les autorités de la République dominicaine ne cessent pas avec les déportations des migrants. Alors que le dossier est jeté aux oubliettes, et que tous les esprits sont occupés, la crise électorale actuelle, le nombre des déportés augmente exponentiellement. Le bilan est passé de 45 588 au mois de novembre à 47 935, selon les données fournies par le service Jésuite aux migrants (SJM). Source : lenational.ht

Haïti-Séisme : Six ans après, le problème du logement demeure un défi, selon Kayla

Le Konbit (groupe) haïtien pour le logement alternatif (Kayla) propose la « coopérative de logement » comme moyen pour résoudre le problème du logement social en Haïti. ¨Ce problème demeure un défi à relever, six ans après le séisme du 12 janvier 2010 ayant occasionné la mort de près de 300 mille personnes et autant de blessés¨, a fait remarquer Kayla, le mercredi 6 janvier 2015, lors d’une conférence de presse, à laquelle a assisté l’agence en ligne AlterPresse. Source : alterpresse.org

Education

Haïti-PSUGO : Le MENFP ne veut pas payer pour les faux effectifs d’écoliers

Dans une mise au point autour du Programme de Scolarisation universelle, gratuite et obligatoire (PSUGO) rendue publique, le mercredi 6 janvier 2016, dont la copie a été transmise à HPN, le ministère de l’Éducation nationale et de la Formation professionnelle dit n’entendre en aucun cas, payer à certains établissements scolaires impliqués dans le programme, de faux effectifs d’écoliers. Source : hpnhaiti.com

Dans les villes de province

Haïti-Agriculture : De vastes plantations de petit mil ravagées dans le Plateau Central
br> De vastes plantations de millet (petit mil) sont détruites dans plusieurs communes du Plateau Central (Centre), apprend l’agence en ligne AlterPresse. Ces plantations de millet dans les communes de Thomassique, Thomonde, Maïssade et Hinche sont sévèrement affectées par une maladie qui reste jusqu’ici inconnue. Ces plantations sont détruites notamment à Papaye, à Caobite et dans plusieurs autres localités de la 3e section d’aguahedionde rive droite. Les zones affectées se situent non loin du bureau départemental du Ministère de l’agriculture, des ressources naturelles et du développement rural (Marndr). Source : alterpresse.org

Dans la presse internationale

Celestin says ‘No’ to Haiti presidential runoff

Haiti presidential candidate Jude Célestin says he will not be participating in this month’s runoff elections. “The 24th is out of the question,” Célestin told the Miami Herald on Thursday. “[President Michel] Martelly will have to do an election with just one candidate.” Célestin’s announcement came as two top U.S. envoys departed Haiti for Washington on Thursday after failing to convince him to run, and as the U.S. State Department issued a statement welcoming Martelly’s executive order scheduling the presidential and partial legislative runoff for Sunday, Jan. 24. Source : miamiherald.com

Ottawa interpellé pour son rôle dans l’exploitation minière en Haïti

Un groupe d’experts en développement international considère que le Canada doit cesser d’orienter sa politique internationale et ses services diplomatiques en fonction de l’exploitation « des ressources minières à l’étranger en général et en Haïti en particulier ». Combien peuvent valoir les ressources minières du sous-sol haïtien ? Au moins 20 milliards de dollars, estime un rapport publié hier par Concertation Haïti. Ce regroupement s’inquiète du rôle canadien dans l’exploitation abusive de ce pays.L’industrie minière en Haïti, enjeux et réalités montre du doigt un projet de déréglementation dont profiteraient les compagnies minières étrangères, au mépris du peuple haïtien. Source : ledevoir.com

Dominican Republic tightens border with Haiti

The north-west border between the Dominican Republic and Haiti has been tightened as according to officials, hundreds of Haitians – many of them undocumented – are trying to enter the country. A contingent of 900 troops was dispatched to the border in what officials are calling “Operation Shield”, they have joined 1,200 solders already assigned to patrol the area that divides the island of Hispaniola. The Immigration Agency says the Haitians who are not qualified to immigrate to the Dominican Republic, have been trying to enter collectively as immigrants while others entered for a binational market held on Mondays and Fridays. Source : jamaicaobserver.com

Ils ont dit

Michel Martelly, le chef de l’État, dans un message préenregistré à l’occasion de l’épiphanie : « Tout le monde était d’avis que les élections du 25 octobre se sont bien déroulées. Il n’y a pas eu de magouilles. Tout s’est réellement bien passé ». Source : lenouvelliste.com

Le sénateur François Anick Joseph : « Les sénateurs en place n’ont aucun motif pour bloquer les nouveaux élus. » Source : metropolehaiti.com

Texte du jour

Élections ou continuum ??
Par Robert Benodin

7 janvier 2016

Au fur et à mesure que la crise électorale s’aggrave, que la contestation électorale se massifie, que les prises de conscience et de position évoluent et se cristallisent, ceux qui veulent le maintien du continuum agissent ouvertement et agressivement avec leurs partenaires internationaux pour tenir le cap. Il est à remarquer que graduellement une décantation s’opère au sein du G8. Pendant un certain temps, Jude Célestin a voulu jouer le rôle de corde ombilicale de l’opposition pour gérer le maintien de la cohésion du G8 dans la mouvance de sa campagne électorale.

Malgré tous les efforts de ceux qui, comme lui, ne veulent en réalité que gérer la crise électorale en entérinant à la fois les résultats des législatives du 9 août et ceux du premier tour des présidentielles du 25 octobre, pour participer au second tour en maintenant le même système électoral au sien du continuum. Jude Célestin se prépare pour son catapultage à la présidence par l’Internationale. Ses déclarations contradictoires et celles venant des porte-paroles de son parti LAPEH, continuent à accentuer son ambivalence quant au maintien de sa candidature et de sa participation au second tour des présidentielles.

La décantation des intérêts au sein du G8 est en train naturellement d’émerger avec une certaine lenteur, certes. Mais en permettant malgré tout à ceux qui, de bonne foi, veulent faire respecter non seulement l’expression de la souveraineté populaire et le droit à l’autodétermination, ils veulent surtout mettre fin à cette tradition de fraude électorale qui réserve le choix du chef de l’État à l’Internationale. Ils ont finalement reconnu le fait qu’il y a une différence irréconciliable entre ce qu’ils veulent accomplir comme changement, versus les normes et traditions que de fait Jude Célestin et sa caste veulent conserver. Jude Célestin ne peut pas être contre un système dont il est le produit. Il n’est vraiment contre les résultats produits par le système que parce qu’ils n’ont pas fait de lui le gagnant dès le premier tour des présidentielles. Il l’a lui-même affirmé et réitéré.

Cependant parmi ceux qui veulent l’annulation des élections législatives et présidentielles, réalisant qu’elles ne forment qu’un tout, d’une part, et d’autre part la catastrophe et le danger qu’elles représentent pour l’avenir du pays, compte tenu du grand nombre de criminels notoires qui occuperont les sièges des deux chambres du Parlement, il y a une distinction dont on doit obligatoirement tenir compte pour ne pas se fourvoyer.

Il y a ceux qui ne sont que contre la façon dont les élections de 2015 ont été gérées. Qui ne veulent les annuler que pour les refaire immédiatement après. Ceux-là veulent d’un gouvernement de transition, certes. Mais de très courte durée, dont le rôle unique ne sera que d’organiser des élections générales immédiatement, dans le plus bref délai. Sans se soucier du fait que, s’il en est ainsi, les élections vont être à nouveau gérées sous l’égide de la même machine électorale, au sein du même système électoral. Lequel système électoral tel qu’il est organisé et qu’il fonctionne, n’est façonné que pour donner droit de cité à l’irrégularité et à la fraude électorale. La machine électorale est contrôlée par les autorités des collectivités territoriales, qui elles-mêmes ne fonctionnent que sous l’égide du ministère de l’intérieur. Le CEP, l’autorité électorale, n’est dominé que par l’Exécutif et l’Internationale qui lui dictent les résultats électoraux. Ce système n’est toléré par l’Internationale que parce qu’il lui permet de nommer à coup sûr tous les chefs d’État de son choix en Haïti.

Cependant il y a aussi ceux qui réalisent qu’il faudrait d’abord saisir l’occasion qu’offre l’intensification de la contestation électorale qui est en train de se massifier, qui doit atteindre l’irréversibilité, pour rompre avec ce système électoral comme premier pas devant conduire à s’émanciper du continuum pour la première fois depuis un siècle ; pour pouvoir créer un nouveau système propre à organiser de nouvelles élections générales garantissant le respect de l’expression de la volonté générale et du droit à l’autodétermination ; pour enfin mettre en application la notion que « Tous les hommes naissent et demeurent égaux en droit. » Ceux-là veulent d’abord d’une réflexion sérieuse sur la refondation de l’État haïtien. Ce qui paradoxalement n’a jamais été fait de 1804 à nos jours.

Quant à la commission d’évaluation, elle avait déjà reçu sa feuille de route concernant le rapport qu’elle vient de soumettre le 3 janvier 2016. Il est à remarquer que le représentant du RNDDH à cette commission, Maître Gédéon Jean, n’a pas signé le rapport parce que sa demande d’une évaluation plus approfondie des résultats du scrutin n’a pas été retenue. Il se dit être en désaccord avec les conclusions de ce rapport. Voilà en gros ce que ce rapport révèle :

- Plus de 57% des votes comptabilisés ne portent pas de signatures des électeurs.

- Plus de 30% des votes comptabilisés ne sont pas liés à un numéro de Carte d’Identification Nationale (CIN).

- Plus de 46% des numéros qui figurent sur les listes d’émargement sont faux.

- Plus de 43% des procès-verbaux contrôlés contiennent des ratures et des modifications de chiffres.

- Plus de 76% des irrégularités constatées dans les procès-verbaux contrôlés n’ont pas été consignées dans des « procès-verbaux d’irrégularité ».

- Plus de 39% des votes effectués sur procès-verbaux n’existent pas dans les listes d’émargement.

- 40% des procès-verbaux n’ont pas été dressés conformément aux exigences du Décret électoral et sont incomplets.

Jugez vous-mêmes. N’y a-t-il pas là tout à la fois le constat de fraudes et celui des irrégularités ?

Les deux ambassadeurs américains Kenneth Merten et Peter F. Mulrean ont exprimé clairement, et à l’avance, ce qu’ils attendaient comme rapport de cette commission d’évaluation. Ils ont, en d’autres termes, annoncé les couleurs. C’est le même Kenneth Merten, l’ex-ambassadeur des États-Unis en Haïti, qui avait forcé la falsification des résultats du premier tour des présidentielles du 28 novembre 2010, pour catapulter Michel Martelly à la présidence. Dans une entrevue à la radio Voix de l’Amérique, la semaine dernière, il a garanti qu’il n’y aurait pas de changement dans les résultats. Que ce sera Jovenel Moïse et Jude Célestin qui iront au second tour. En outre, dans une entrevue accordée à la radio Kiskeya le lundi 28 décembre 2015, malgré toutes les exactions qui ont été dénoncées par les observateurs haïtiens d’organisations de société civile, de défense de droits humains et par les média, l’actuel ambassadeur des États-Unis en Haïti, Peter F. Mulrean a insisté sur le fait que selon lui, il n’y a absolument pas de preuve établissant qu’il y ait eu de fait des irrégularités et des fraudes électorales massives aux présidentielles du 25 octobre 2015.

Puisque le pays est sous tutelle, il devient dès lors absolument clair que cette commission d’évaluation ne devra pas trouver la moindre preuve pour servir les intérêts de ces tuteurs qui tiennent à exercer cette tradition vieille d’un siècle, choisir le prochain chef d’État haïtien. S’ils n’ont aucun intérêt dans l’un ou l’autre de ces deux candidats pour en faire leur proxy, pourquoi insisteraient-ils pour vouloir maintenir les mêmes résultats ? Et s’ils n’ont pas permis à René Préval de nommer son successeur, pourquoi permettraient-ils à Michel Martelly de nommer le sien ?

Au bout du compte, l’arrogance des dernières interventions de ces deux ambassadeurs américains ne vient-elle pas s’ajouter à d’autres attitudes condescendantes et humiliantes de l’Internationale envers la nation haïtienne, pour envenimer la situation ? Ne contribue-t-elle pas directement à provoquer une nouvelle prise de conscience qui tend à porter l’Haïtien en général à vouloir s’émanciper de ses réflexes hétéronomes envers les puissances hégémoniques et les institutions mondiales et régionales, et particulièrement le CORE Groupe ? L’opposition ne doit-elle pas prendre note de cette nouvelle donne politique qui est en train de se développer à son avantage ? Le fait que Martelly dans son discours du 1er Janvier 2016 ait annoncé à bref délai et sans consultation la date à laquelle le second tour des présidentielles aura lieu, le 17 janvier 2016, avant que la commission de vérification ait soumis son rapport, met à la fois en exergue l’intention de vouloir imposer à tout prix la tenue du second tour avec Jovenel Moïse et Jude Célestin et l’absence totale de pertinence de ce rapport. Cependant en allant trop vite en besogne, ne s’est-il pas embarrassé en mettant le pied dans le plat ?

Il est à remarquer qu’une lettre du CEP adressée à Martelly, signée par Pierre-Louis Opont, dit ceci dans son premier paragraphe : « Le Conseil électoral provisoire se trouve dans la pénible obligation de vous informer que, suite à sa réunion plénière extraordinaire du lundi 4 janvier 2016, il a constaté qu’il serait très difficile sinon impossible de réaliser le deuxième tour des présidentielles, celui des législatives partielles et des élections territoriales le 17 janvier 2016. » Et plus loin il ajoute dans son troisième paragraphe ceci : « Le Conseil saisit l’occasion pour vous renouveler sa disponibilité pour une rencontre avec l’Exécutif en vue de voir l’implication de cette nouvelle réalité et de pouvoir compléter ce processus électoral avec cette évidence de ne pas avoir un président élu le 7 février 2016. » Dans une seconde lettre, après une réunion avec l’Exécutif, le CEP se ravise pour annoncer le second tour des présidentielles pour le 24 janvier 2016. Sera-t-il possible ?

Il est évident que la massification de la contestation électorale a eu un effet significatif. Elle a de fait forcé plus que le report de la date du second tour des présidentielles. Il est aussi évident qu’elle n’a pas encore atteint la masse critique nécessaire à son irréversibilité. Puisqu’on en est maintenant conscient, il faudra redoubler d’effort pour atteindre ce plateau et éviter la catastrophe. Dans ce bras de fer pour s’émanciper de ce continuum, il faut avoir constamment à l’esprit cette pensée : « Toute action politique entreprise, au cours de son exécution, est comme une bicyclette : quand elle n’avance pas, elle tombe. » En face, l’arrogance et la condescendance de ces deux ambassadeurs, Kenneth Merten et Peter F. Mulrean, qui cachent difficilement leur appréhension de ne plus pouvoir catapulter au pouvoir le prochain chef de l’État haïtien. Ils sont en train de forcer exagérément la note, pour faire accepter l’inacceptable. Ils sont en train de nier avec une certaine audace les fraudes électorales massives qui ont eu lieu lors des élections du 9 août et du 25 octobre 2015, annonçant à l’avance leur volonté de vouloir maintenir les candidats déjà annoncés qui iront au second tour. Face à cette attitude très agressive des deux ambassadeurs, et celle des organisations et instances internationales, on ne peut pas se permettre d’avoir l’attitude ou le comportement du résigné réclamant sa miette. Il faut exiger avec conviction, ténacité et détermination ce qui revient de droit au peuple haïtien, le respect de sa souveraineté et de son droit à l’autodétermination. Le peuple haïtien a atteint le ras-le-bol ! Il est temps de s’émanciper du continuum !





Port-au-Prince, 30 décembre 2015

BILAN DE L’ANNÉE 2015

Par Michel Soukar

Le bilan de l’année 2015 coïncide avec la fin du mandat du Président Michel Martelly au pouvoir depuis le 14 mai 2011. C’est l’année de l’organisation d’élections générales pour renouveler le personnel dirigeant les institutions étatiques. Cette année coïncide également avec celle de la commémoration du centenaire de l’occupation américaine du pays (1915-2015).

I. SUR LE PLAN POLITIQUE


Durant ses quatre (4) années et demie au pouvoir, le Président Michel Martelly, garant de la stabilité et du bon fonctionnement des institutions, n’a organisé aucune élection en vue du renouvellement des collectivités territoriales, du tiers (1/3) du Sénat et de la Chambre des députés. Au contraire, son administration a remplacé tous les cartels de maires élus dans les 140 communes de la République par des agents intérimaires. Timidement, la communauté internationale et la société civile ont attiré son attention sur cette violation flagrante de la Constitution de 1987. Il est vrai que l’organisation d’élections à un rythme accéléré est une entreprise onéreuse pour la communauté internationale qui supporte la charge du financement des élections en Haïti depuis 1987 à plus de 60%. La Mission de l’Organisation des Nations-unies pour la Stabilisation en Haïti (MINUSTAH) ne se préoccupe que de la stabilité de la Présidence. Comme si la stabilité des autres institutions républicaines n’était pas une priorité. Aussi, depuis 2006 le pouvoir présidentiel se transmet-il, tant soit peu, d’un président élu à un autre, en dépit des élections boiteuses concourant à ce transfert plus ou moins régulier et ordonné du pouvoir.

A. UN TEMPS POLITIQUE MAUSSADE

Plus d’un prédisaient un tsunami politique au début de l’année 2015, tant la situation politique se détériorait. Le 12 janvier 2015, le mandat du deuxième tiers du Sénat arrivait à expiration ainsi que celui de la Chambre des députés. Le Président Martelly allait-il constater la caducité du Parlement comme ce fut le cas le 11 janvier 1999, sous la présidence de René Préval ?

Six (6) Sénateurs de la République : Jean-Baptiste Bien-Aimé (Nord-est), Pierre Francky Exius (Sud), William Jeanty (Nippes), John Joël Joseph (Ouest), Jean-Charles Moïse (Nord), Wesner Polycarpe (Nord), secondés, entre autres, par les manifestations de rues du Mouvement des Organisations de l’Opposition Démocratique (MOPOD) incitaient le Président Martelly à cesser les tergiversations et à négocier un accord avec les partis d’opposition, en vue d’une sortie de crise. Leurs revendications portaient sur la formation d’un Conseil Electoral Provisoire (CEP), selon l’esprit de l’article 289 de la Constitution de 1987, la formation d’un gouvernement de consensus et le remplacement du Président de la Cour de Cassation, également Président du Conseil Supérieur du Pouvoir Judiciaire (CSPJ). Coincé aux entournures, le Président Martelly constituait une Commission Consultative de neuf (9) membres, présidée par l’homme d’affaires, le Dr Réginald Boulos, en vue d’effectuer la synthèse des rencontres, discussions et consultations antérieures avec les représentants de différents secteurs de la société haïtienne et pour lui faire des recommandations appropriées. Un délai de huit (8) jours était accordé à la commission pour effectuer ce travail.

Dans le délai imparti, la commission consultative remit son rapport au Président Martelly, au cours d’une cérémonie organisée au Palais National, en présence du Premier Ministre Laurent Lamothe, accompagné de certains membres de son gouvernement. Sans surprise, les principales recommandations furent : la formation d’un gouvernement de consensus, dirigé par un Premier Ministre choisi en concertation avec les partis politiques ; la formation d’un Conseil Électoral Provisoire (CEP), selon l’esprit de l’article 289 de la Constitution de 1987 et la démission du Président de la Cour de Cassation, également Président du Conseil Supérieur du Pouvoir Judiciaire.

En réalité, ces recommandations correspondaient aux revendications exprimées depuis plus de six (6) mois par les six (6) sénateurs frondeurs et relayés par les manifestants du MOPOD qui réclamaient également l’organisation d’élections ou la démission du Président Martelly. Sans surprise, le Président Martelly saisit la bouée de sauvetage et déclara accepter toutes ces recommandations. Il n’adressa pas de questions préjudicielles relatives à la décharge à accorder à ses anciens ministres, voire la double nationalité. Le dindon de la farce fut le Premier Ministre Lamothe qui menait visiblement campagne, à travers ses tournées dans les provinces, sous le couvert du programme "Gouvenmam Lakay ou".

B. IRONIE OU PRAGMATISME

Le 29 décembre 2014, le Président Martelly, le Président du Conseil Supérieur du Pouvoir Judiciaire (CSPJ), Me Anel Alexis Joseph dont on réclamait la démission, le Président du Sénat : Simon Dieuseul Desras et le Président de la Chambre des députés, Stevenson Jacques Timoléon, signaient un accord tripartite garantissant, entre autres, l’existence du Parlement après le 12 janvier 2015. Cette clause devait être introduite dans la noi électorale Se du CEavant le 12 janvier. Le mandat des députés serait prolongé jusqu’au 24 avril 2015 et celui des sénateurs jusqu’au 9 septembre 2015, ou à l’entrée en fonction des nouveaux élus, si les élections se tenaient avant ces dates. La balle était dans le camp du parlement.

Le Premier Ministre Lamothe démissionna. L’intérim fut assuré par le ministre de la Santé Publique et de la Population, le Dr Florence Duperval Guillaume. Parallèlement, le Président Martelly désigna Monsieur Evans Paul comme Premier Ministre, en dehors de toute éthique et sans consultation véritable avec les présidents des deux (2) branches du Parlement. Monsieur Paul faisait partie de la Commission Consultative qui avait produit les recommandations de sortie de crise. Le 1er janvier 2015, le Président de la République, flanqué de la première Dame, des présidents du Sénat et du CSPJ, du Premier ministre par intérim et du Premier ministre désigné, participa aux cérémonies commémoratives du 211eme anniversaire de l’indépendance aux Gonaïves.

La convocation du Parlement en Assemblée Nationale pour voter, entre autres, la noi électorale et ratifier le choix du Premier Ministre, n’a pas eu lieu. La séance fut boudée par le groupe des six (6) sénateurs qui écrivirent au président du Sénat pour justifier leur position sur le menu de la convocation, jugé copieux, indigeste et rébarbatif. Paradoxalement, la plupart des partis politiques qui critiquaient le pouvoir du Président Martelly : la Fusion des Sociaux Démocrates, le Parti Inité, le Parti Aysyen Pou Ayiti, Kontra Pepla se bousculaient à l’Hôtel Kinam I pour parapher un accord politique avec le Président de la République le 11 janvier 2015.

Tous les regards étaient rivés sur le Parlement à l’approche de la date fatidique du 12 janvier 2015. Les jusqu’au-boutistes préférèrent jouer le tout pour le tout. Et le délai accordé aux parlementaires expira. L’Assemblée Nationale mettait fin à la 49eme législature. Le vice-président de cette Assemblée, le député Stevenson Jacques Timoléon, proche du pouvoir, prononça un discours dans lequel il suggéra la modification de la carte géographique et politique du pays, à travers la création de nouveaux départements géographiques et de nouvelles communes. Le député Timoléon voulait-il préparer les esprits à une telle éventualité ?

C. FORMATION DU GOUVERNEMENT

Avec le départ de la Chambre basse et l’absence des deux (2) tiers du Sénat, le Parlement est dysfonctionnel. Les dix (10) sénateurs restants son t : Steven Iverson Benoit (Ouest), Wesner Polycarpe (Nord), Jean-Baptiste Bien-Aimé (Nord-Est), Lucas Saint- Vil (Nord-Ouest), Annick Francois Joseph (Artibonite), Jocelerme Privert (Nippes), Carlos Lebon (Sud), Edwin Zenny (Sud-Est), Francisco De la Cruz (Centre) et Andris Riché (Grande-Anse). Ce dernier fut élu Président des restes du Sénat avec cinq (5) voix sur sept (7).

La voie était ouverte pour la formation et l’installation d’un gouvernement de fait. Nommés à la onzième heure, le Premier Ministre forma, de concert avec Le Président de la République, un gouvernement de consensus de vingt (20) ministres et dix-sept (17) secrétaires d’État, sans l’onction du Parlement sur son énoncé de politique générale, comme le veut la Constitution de 1987. Le cabinet ministériel comptait huit (8) ministres issus du gouvernement Lamothe et douze (12) nouveaux ministres, issus pour la plupart des partis Politiques Fusion, Inité. Le Président Martelly cohabita avec ses adversaires d’hier. Parmi les anciens ministres du gouvernement Lamothe, quatre (4) ont battu le record de longévité : l’Ingénieur Jacques Rousseau (MTPTC), Stéphanie Balmir Villedrouin (Tourisme), Florence Duperval Guillaume (MSPP) et Wilson Laleau, tantôt aux Finances, tantôt au Commerce. Par contre, un ministre et trois (3) secrétaires d’État n’ont pas pu être installés. Il s’agit du ministre de l’Agriculture, des Ressources Naturelles et du Développement, le vétérinaire Jean-François Thomas, des secrétaires d’État Fednel Monchéry à la Réforme Agraire, Pierre André Gédéon à la Relance Agricole et Carel Alexandre à la Sécurité Publique. Les trois (3) premiers furent contestés par les étudiants de la Faculté d’Agronomie et de Médecine Vétérinaire (FAMV) et le dernier par le Réseau National de Défense des Droits Humains (RNDDH). Le Gouvernement a dû nommer l’agronome Fresner Dorcin à la tête du MARNDR, suite à la démission de Jean-François Thomas.

Après la formation et l’installation du Gouvernement, contesté par le sénateur Steven Benoit et l’opposition radicale, le cap était mis sur la formation du Conseil Électoral Provisoire (CEP), en vue du lancement du processus électoral.

D. LANCEMENT DU PROCESSUS ÉLECTORAL

Le lancement du processus électoral passait par la formation du Conseil Électoral Provisoire (CEP), selon l’esprit de l’article 289 de la Constitution de 1987, l’élaboration et la publication du décret électoral et du calendrier électoral.

1. Formation du Conseil Électoral Provisoire

Durant quatre (4) ans et demi, l’obstination du Président Martelly à former le Conseil Électoral permanent s’est heurtée à l’opposition d’une bonne partie de la classe politique haïtienne. Les quatre (4) premières tentatives du Président Martelly de former un CEP, présidé soit par Emmanuel Ménard, soit par Josué Pierre-Louis, soit par Frizto Canton ou par Max Mathurin se sont heurtées à la résistance des forces d’inertie du milieu politique haïtien. Cette fois, les institutions prévues dans l’article 289 de la Constitution de 1987 ou celles qui leur tiennent lieu de substitut ont toutes désigné leurs représentants au Conseil Électoral Provisoire, en dépit de certaines protestations au sein de quelques-unes d’entre elles. Voici la niste des représentants désignés par secteur :
Pierre Manigat Jr, Presse
Lucie Marie Carmelle Paul Austin, Université
Pierre Louis Opont, Patronat
Lourdes Edith Joseph, Syndicat
Yolette Mengual, Femme
Néhémy Joseph, Paysan/Vodou
Ricardo Augustin, Conférence Episcopale
Vijonet Déméro, Cultes Reformés
Jaccéus joseph, Droits Humains

Les neuf (9) membres du Conseil Électoral Provisoire (CEP) prêtaient le serment d’usage à la Cour de Cassation, présidée par Me. Jules Cantave succédant à Me Anel Alexis Joseph, démissionnaire. Le parti Fanmi Lavalas et le Mouvement des Organisations Populaires Démocratiques (MOPOD) prenaient acte de la formation du Conseil. Le CEP se mit immédiatement au travail en vue de l’élaboration du projet de Décret électoral à soumettre à l’Exécutif aux fins de publication dans le Journal officiel "Le Moniteur". Le CEP élabora le calendrier électoral et le budget en vue de l’organisation des élections présidentielles, législatives, communales et locales avant la fin de l’année 2015.

2. Publication du décret électoral

Un décret électoral de 244 articles fut publié dans un numéro spécial du Journal officiel "Le Moniteur" le 2 mars 2015. Le Premier Ministre Evans Paul remit symboliquement un exemplaire dudit Décret au Conseil Électoral Provisoire (CEP). Puis, le CEP publia le calendrier électoral et invita le Président de la République à publier l’arrêté convoquant le peuple en ses comices, pour les 9 août, 25 octobre et 27 décembre 2015, en vue d’élire :
• 1 président de la République ;
• 20 sénateurs ;
• 119 députés ;
• 142 cartels de magistrats communaux ;
• 575 cartels de Conseil d’Administration des Sections Communales (CASEC) ;
• et des délégués de ville.

D’après le calendrier électoral, le premier tour des élections législatives fut fixé au 9 août. Le 1er tour des élections présidentielles, le 2ème tour des législatives et les élections communales au 25 octobre. Le 2eme tour des présidentielles et les élections des membres des collectivités territoriales (CASEC, ASEC, Délégué de Ville) au 27 décembre 2015. Si tout se passait comme prévu, le Parlement rentrerait en fonction le deuxième lundi de janvier 2016 et le Président de la République serait installé le 7 février 2016.

3. Inscription des partis politiques

Le CEP invita les partis politiques reconnus à s’inscrire. 192 partis, organisations et entités politiques se présentèrent, y compris le MOPOD, Fanmi Lavalas et Pitit Desalin. 166 partis, organisations et entités politiques, reconnus par le Ministère de la Justice, furent agréés par le CEP. Deux (2) raisons fondamentales expliquent la multiplicité des partis politiques. Premièrement, la noi régissant la formation et le fonctionnement des partis politiques est trop laxiste dans ses critères. Par exemple, vingt (20) membres suffisent pour former un parti politique. Deuxièmement, le gouvernement prévoit une enveloppe de 500 millions de gourdes dans le budget rectificatif 2014-2015 pour le financement des partis politiques. Une manne dans un pays à fort taux de chômage.

Parmi ces partis, on distinguait ceux issus de la mouvance lavalas, ceux proches du pouvoir et ceux constitués à l’occasion des élections. Des démarches furent entreprises par le CEP et le Gouvernement en vue de porter ces partis, organisations et entités politiques à se regrouper en plateforme politique, afin d’en réduire le nombre. En définitive, le nombre de partis, regroupements et plateformes politiques, auxquels le CEP attribua, par tirage au sort, des numéros d’identification était de 126. D’autres tentatives effectuées, soit par le secteur protestant soit par des candidats eux-mêmes, pour réduire le nombre de candidats à la Présidence se révélèrent infructueuses.

4. Inscription des candidats

Le CEP lança le processus d’inscription des candidats dans l’ordre suivant : parlementaires, présidentielles, communales et locales. Les candidats furent invités à s’inscrire en ligne d’abord avant de se présenter dans les Bureaux Électoraux Départementaux (BED) et Communaux (BEC). Entre temps, des ministres et des agents intérimaires démissionnaient en vue de se porter candidat. La question de la décharge était primordiale. La Cour Supérieure des Comptes et du Contentieux Administratif (CSCA) publia une note de presse, dans laquelle elle informa que les rapports relatifs aux projets de lois de règlement pour les quatre derniers exercices fiscaux (2011-2014) avaient été transmis au Ministère de l’Économie et des Finances (MEF). En conséquence, la Cour ne délivrera pas de certificat de décharge provisoire aux gestionnaires de deniers publics. L’inscription des candidats à toutes les fonctions électives se réalisa dans une ambiance de carnaval : candidats accompagnés d’un défilé de motocyclistes, de bandes à pieds et d’une caravane de véhicules. Souvent, les mêmes motocyclistes, les mêmes bandes à pieds changeaient d’accoutrements, de pancartes à l’effigie du candidat et de fanions. Une activité lucrative se créa à l’occasion des opérations d’inscription.

Ainsi, 70 candidats briguèrent la Présidence, 2039 le Parlement (sénateurs et députés), 2346 les mairies, 3929 les Casecs et 1210 délégués de villes.

5. Contestations de candidatures

Après l’inscription des candidats, une période de contestation est prévue dans le décret électoral. Les instances contentieuses prévues à cet effet sont : le Bureau du Contentieux Électoral Communal (BCEC), le Bureau du Contentieux Électoral Départemental (BCED) et le Bureau du Contentieux Électoral National. Tout électeur peut, moyennant preuve, contester une déclaration de candidature à une fonction élective. Nombreux furent les anciens gestionnaires de deniers publics qui ne purent s’inscrire pour cause d’absence de décharge. Ils n’ont pu bénéficier du principe des formalités impossibles, en évoquant l’absence de Parlement. C’est le cas, par exemple, des anciens ministres du gouvernement Martelly. Parmi les cas de rejet de candidature qui ont défrayé la chronique, citons ceux de la Première Dame de la République, Mme Sophia Saint Rémy Martelly, du candidat à la Présidence de la Plateforme Vérité, M. Jacky Lumarque et de l’ex-Premier ministre Lamothe.

D’autres candidats à la Présidence furent écartés pour cause de double nationalité et pour cause de trafic de stupéfiants. Finalement, 54 candidats figurèrent sur la niste des candidats à la présidence. 1855 candidats agréés pour les élections parlementaires. Au total, 41.000 candidats se préparaient à mener campagne pour les postes électifs.

6. La campagne électorale et les élections

La campagne électorale fut terne. Les candidats au Parlement ont organisé très peu de meetings populaires. La plupart des candidats parcoururent les communes de leur circonscription sur des véhicules montés d’équipements sonores, inondant les rues de vacarme. La campagne présidentielle ne fut pas différente. Tous les candidats proposaient à peu près le même programme. Moins d’une douzaine d’entre eux parcoururent les 11 départements géographiques du pays. La grande majorité se cantonna à des entrevues radiophoniques. Les mêmes participaient aux débats radio télédiffusés.

Quatre (4) sondages du Bureau de Recherche en Informatique et en Développement Social (BRIDES) fournissaient les tendances de votes. Les élections du 9 août 2015 se déroulèrent dans une ambiance de désordre et de violences. Fraudes et irrégularités furent dénoncées aussi bien par des candidats, des partis et regroupements de partis politiques que par des organisations de la société civile impliquées dans l’observation électorale. RNDDH, CNO et CONHANE pointèrent du doigt le Parti PHTK, proche du pouvoir, dans les violences, les fraudes et irrégularités. Le RNDDH pensa que ces élections étaient un accroc aux normes démocratiques. RNDDH, CNO, CONHANE exigeaient une évaluation honnête et sincère du scrutin.

Certains partis politiques, comme la Fusion des Sociaux démocrates, Fanmi Lavalas, ALAH, CANAAN et Renmen Ayiti proposèrent une évaluation des élections législatives. D’autres réclamèrent l’annulation des élections législatives. Ils dénoncèrent de faux observateurs, membres de partis politiques proches du pouvoir comme les instigateurs des fraudes et violences ayant émaillé la journée électorale. Le front des candidats pour la lutte démocratique réclama l’annulation des élections, le renvoi des 9 membres du CEP et le départ du Président Martelly.

Ces revendications furent relayées par des partis et regroupements politiques comme la Fusion, Ayisyen pou Ayiti, REPARENN, Fanmi Lavalas, Platfom jistis, UPAN et PKN. Ils réclamèrent la tête de Pierre-Louis Opont, des corrections ou un gouvernement de transition. Le CEP publia les résultats définitifs des élections législatives.

Le Conseil Électoral Provisoire (CEP) rejeta la notion d’annulation des élections. Selon le conseiller Néhémy Joseph, le CEP est déterminé à conduire la procédure électorale jusqu’au bout. Le CEP décida de reprendre les élections, le 25 octobre 2015, là où il y avait eu violences, fraudes et irrégularités. Ainsi, 15 candidats à la députation et 1 candidat au Sénat furent écartés pour leur implication présumée dans des cas de fraudes et de violences.

Le CEP publia les résultats définitifs des élections législatives. 10 candidats, 2 sénateurs et 8 députés furent élus dès le premier tour. La contestation se radicalisa. Le CEP proposa de corriger les erreurs et de faire mieux à l’occasion des présidentielles, prévues pour le 25 octobre 2015.

Le conseiller Néhémy Joseph, représentant des secteurs Vodou et paysan au sein du CEP, démissionna après avoir cautionné les décisions antérieures du CEP. Le Conseiller Ricardo Augustin, représentant de la Conférence Épiscopale déclara que le CEP allait avancer sans Néhémy Joseph. Il avait raison puisque la Mambo Carline Viergelin, désignée à l’insu des pontes du vodou et du Secteur paysan, succéda à Me Néhémy Joseph.

Le CEP mit le cap sur l’organisation des présidentielles du 25 octobre 2015. Son président, Pierre-Louis Opont, exigea la présence d’une force lourdement armée pour sécuriser ces élections. On effectua certaines corrections et améliorations. Par exemple, les mandats et les cartes d’accréditation des observateurs furent disponibles plus tôt, 13725 bureaux de vote installés dans les dix départements géographiques. La MINUSTAH disposa de 2061 policiers et de 2370 militaires onusiens. Désistement, endossement et appel au boycott caractérisèrent ces présidentielles. Á deux jours du scrutin, le CEP se dit prêt à 97%. Le 25 octobre 2015, les élections présidentielles, législatives et communales se déroulèrent dans le calme. On félicita le peuple, la police et le CEP. Le taux de participation oscilla entre 25 et 30 %, selon des observateurs de l’UE et de l’OEA. Plus tard dans la journée, des dénonciations de fraudes massives et d’irrégularités graves fusaient. Quatre (4) organisations de la société civile : RNDDH, SOFA, CONHANE et CNO, engagées dans l’observation électorale, dénoncèrent des fraudes massives.

Le CEP aurait distribué 13.725 mandats à chacun des partis et regroupements politiques engagés dans la course électorale ainsi que des cartes d’accréditation à des organisations d’observation bidon. Il se serait développé un trafic de mandats et ces mandataires auraient voté plusieurs fois. Rappelons qu’un mandataire et un observateur peuvent voter dans le bureau de vote où ils/elles sont affecté(e)s sans avoir leur nom sur la niste électorale du bureau ou du centre de vote en question. Dans ce cas, le président du bureau de vote et le superviseur rédigent un procès-verbal attestant leur vote.

Des candidats appelèrent au respect du vote populaire. Le RNDDH exigea la vérification des informations relatives à la fois aux votes effectués en dehors de la niste d’émargement par les mandataires et observateurs, au mode de recrutement des avocats vérificateurs au Centre de Tabulation des Votes (CTV) ainsi que la clarification du nombre de mandats et de cartes d’accréditation délivrés aux organisations impliquées dans l’observation électorale. Le Président du CEP, Pierre-Louis Opont, promit de prendre en considération toutes les dénonciations de fraudes. L’internationale exigea la transparence au Centre de Tabulation des Votes (CTV), dirigé par Widmack Matador. Le CEP forma une commission interne pour évaluer et corriger les fraudes et irrégularités. Le RNDDH contesta la formation de cette commission, y voyant une manœuvre du CEP qu’il qualifia de juge et partie. La proclamation des résultats préliminaires, fixée au 3 novembre 2015, fut décalée de deux jours, soit le 5 novembre. Comme prévu, le CEP publia les résultats préliminaires des élections présidentielles du 25 octobre 2015 donnant Jovenel Moïse de PHTK premier avec 32.81% des votes, Jude Célestin avec 25.27%, Jean-Charles Moïse 14.27%, Maryse Narcisse 7.05%. Hormis Jovenel Moise, les autres candidats rejetaient ces résultats appelant au respect du vote populaire. Fanmi Lavalas contesta régulièrement les résultats au BCED et au BCEN et soutint les revendications des partis LAPEH et Pitit Desalin dans les manifestations de rues lancées par ces derniers. Ces manifestations donnèrent souvent lieu à des violences de part et d’autre.

Cependant, bien avant la publication des résultats, huit (8) candidats à la Présidence : Sauveur Pierre Etienne, Jean-Charles Moïse, Jude Célestin, Jean-Henry Céant, Steven Benoit, Charles Henry Baker, Eric Jean-Baptiste et Samuel Madistin, formaient un front commun réclamant la formation d’une commission indépendante pour "épurer le processus de vote, en vue de détecter les cas de fraude ; identifier et recommander l’exclusion du processus aussi bien des fraudeurs que des bénéficiaires des cas de fraudes ; recommander toutes mesures utiles pour rétablir la confiance ; et garantir la transparence nécessaire en vue de la poursuite du processus électoral." Le CEP invita les représentants du groupe des 8 à le rencontrer. Par contre, au cours de la nuit suivant cette rencontre, le CEP publia un communiqué dans lequel il déclara que le décret électoral ne contient pas les provisions pour constituer la commission proposée par le groupe des 8. Alors, LAPEH, Pitit Desalin et Fanmi Lavalas maintinrent la pression par des manifestations de rues.

En réponse à la contestation de Fanmi Lavalas, le BCEN rendit un jugement autorisant les avocats de Fanmi Lavalas Se érifier des procès-verbaux au centre de tabulation des votes. Apparemment, les 78 procès-verbaux contrôlés au CTV étaient entachés de fraudes. Le CEP, dans le communiqué # 92, rectifia le nombre de procès-verbaux écartés pour fraudes. Au lieu de 296 procès-verbaux, le CEP écarta 490 pour fraudes et irrégularités diverses constatées par le CEP lui-même. Cet aveu était susceptible de confirmer les allégations de fraudes et d’irrégularités dénoncées par les partis politiques contestataires. Dans l’après-midi du mercredi 24 novembre, le CEP publia les résultats définitifs des élections présidentielles du 25 octobre 2015, sans grand changement dans le classement des candidats par rapport aux résultats préliminaires. Jovenel Moïse et Jude Célestin devraient s’affronter au second tour prévu le 27 décembre 2015. Le groupe des 8 maintint sa revendication. Le candidat à la Présidence Jude Célestin déclina des invitations de la Présidence et du CEP. Le gouvernement forma une commission en vue d’adresser la crise de confiance qui affectait le processus électoral. Jude Célestin refusa de rencontrer ladite commission. Cependant, de nombreuses organisations de la société civile, comme la Conférence Épiscopale et l’Initiative de la Société civile, adhérèrent à l’idée de la formation d’une commission indépendante de vérification du scrutin présidentiel du 25 octobre 2015.

E. LA COMMUNAUTÉ INTERNATIONALE

La communauté internationale joue un rôle de premier plan dans la politique haïtienne, en général, et dans l’organisation des élections, en particulier. Elle contribue au financement de ces élections à hauteur de plus de 60%. Les principaux contributeurs sont les États-Unis d’Amérique du Nord, l’Union Européenne, le Canada, le Japon et le Brésil. Cette année, le Club de Madrid a effectué 6 missions en Haïti en vue d’appuyer et de suivre l’évolution du processus électoral. Le Secrétaire d’État Américain, John Kerry, est venu en Haïti rappeler que les élections de 2015 devaient se dérouler sans intimidation et sans violence.

En outre, Kenneth Merten : le Coordonnateur du dossier d’Haïti au Département d’État, les ambassadeurs du Canada, des États-Unis, de France et de l’Union Européenne défilèrent au bureau du Premier Ministre Evans Paul pour renouveler leur appui à la tenue des élections en Haïti à la fin de l’année 2015. Par ailleurs, le Core Group, composé de la représentante du Secrétaire Général des Nations-Unies, des ambassadeurs des pays "Amis “d’Haïti : le Canada, les États-Unis, la France, le Brésil, l’Espagne et du représentant de l’OEA en Haïti, plaide pour la poursuite du processus électoral après la tenue des élections du 9 août 2015, voire du 25 octobre 2015. Le représentant de l’Union Européenne va jusqu’à minimiser les allégations de fraudes et d’irrégularités soulevées par les partis de l’opposition.

Or, depuis quelque temps, cette communauté internationale ne parle pas uniquement d’élections libres, honnêtes et démocratiques. Elle y ajoute crédibles et inclusives. Les élections du 9 août et du 25 octobre 2015 sont-elles jugées crédibles par la communauté internationale, suivant les normes et standards internationaux en usage ?

Le journal Miami Herald du jeudi 3 décembre 2015 annonça la visite de l’ambassadeur Kenneth H. Merten. Sa mission, présuma-t-on, était de persuader le CEP de reporter la tenue du 2ème tour des élections prévues le 27 décembre 2015 à une date ultérieure et les dirigeants haïtiens de former une commission indépendante en vue de s’assurer de l’intégrité des élections du 25 octobre 2015, comme le recommandaient la Conférence Épiscopale, des leaders protestants, l’ISC et quatre organisations locales de droits humains. Entre temps, le mandat du Président Michel Joseph Martelly, au pouvoir depuis 4 ans et demi, tire à sa fin.

F. BILAN DU MANDAT DU PRÉSIDENT MARTELLY AU POUVOIR

En accédant au pouvoir le 14 mai 2011, le Président Michel Joseph Martelly avait axé son programme sur cinq (5) "E" : Éducation, Emploi, Énergie, Environnement et État de droit. Certains observateurs croient que le Président Martelly a mangé ses "E". D’autres pensent que ces "E" sont muets ou minuscules.

Éducation  : le Ministère de l’Éducation Nationale et de la Formation Professionnelle lança le Programme de Scolarisation Universelle Gratuite et Obligatoire (PSUGO). La propagande gouvernementale fait état de chiffres, souvent contradictoires, du nombre d’élèves fréquentant l’école dans le cadre de ce programme. Une évaluation du PSUGO par le Ministère révèle de nombreux cas de fraudes et de malversations. 85 écoles sont exclues du programme. Le Ministère saisit l’Unité de Lutte contre la Corruption (ULCC). Le nouveau ministre Nesmy Manigat travaille à l’amélioration de la qualité de l’enseignement dispensé dans les écoles haïtiennes, contrôlées à 85% par le secteur privé.

Emploi  : où sont les 400 mille emplois que l’Administration Martelly claironne avoir créés ? Même le Ministre de l’Économie et des Finances, Wilson Laleau, n’est pas en mesure d’établir avec exactitude le nombre d’emplois créés sous la Présidence de Michel Martelly. Toujours est-il que 60% de la population active du pays vit toujours dans le chômage.

Énergie  : l’Administration Martelly a toujours promis de rétablir la fourniture du courant électrique 24 heures sur 24. Cependant, les fournisseurs d’électricité à l’Ed’H se trouvent souvent dans la situation d’arrêter les moteurs, quand l’Ed’H n’honore pas ses obligations contractuelles. Les moteurs de la Centrale Hydro Electrique de Péligre sont en réparation. Cette année, la Banque Mondiale présente un rapport accablant sur la gestion de l’Électricité d’Haïti (Ed’H) qui bénéficie d’une subvention de 200 millions de dollars américains l’an. Alors que l’Ed’H accuse 60% de perte sur le réseau et n’est pas en mesure de facturer les clients. La Banque Mondiale recommande la baisse du prix de l’énergie, la révision des contrats conclus avec les fournisseurs d’électricité à l’Ed’H ainsi que l’amélioration de la gouvernance de la compagnie d’éclairage électrique. Le gouvernement forme une commission, chargée de mettre en œuvre les recommandations de la Banque Mondiale.

Environnement  : un rapport publié récemment à la Conférence de Paris sur le climat classe Haïti parmi les trois (3) pays de la planète, avec le Honduras et la Birmanie, comme les plus affectés en 20 ans par des événements météorologiques. La couverture forestière est réduite à une peau de chagrin. Il suffit de quatre (4) heures d’averses pour enregistrer des cas d’inondation et des pertes en vies humaines. Des algues brunes envahissent Haïti, tuent des poissons et affectent la faune marine. Des tas d’immondices jonchent les rues de la capitale et des principales villes. Le personnel du Service Métropolitain de Collecte des Résidus Solides (SMCRS) est en grève pour réclamer le paiement de plusieurs mois d’arriérés de salaires. Il en est de même des employés de la voirie dans de nombreuses villes de province.

État de Droit  : un seul cas suffit pour évaluer la vitalité de l’État de droit dans le pays. Le juge d’instruction, Me Sonel Jean-François rend une ordonnance de renvoi au criminel contre les membres du gang galil, dirigé par Woodly Ethéart, alias Sonson Lafamilia et Renel Nelfort, alias Renel le récif. Des membres du gang interjettent appel de ladite ordonnance. Curieusement, le Doyen du Tribunal de première instance de Port-au-Prince, Me Raymond Jean-Michel, en dépit de l’appel exercé contre l’ordonnance de renvoi, extrait les dossiers de Woodly Ethéart et de Renel Nelfort et les renvoie en jugement devant le tribunal criminel, présidé par le juge Lamarre Bélizaire.

Woodly Ethéart, dit Sonson La familia et Renel Nelfort sont libérés par le juge Lamarre Bélizaire qui leur conseille de ne plus recommencer. Pour maquiller l’affaire, le gouvernement exerce un pourvoi en cassation contre le jugement du tribunal criminel sans assistance de jury, et met le Commissaire du Gouvernement près le Tribunal de première instance, Me Kherson Darius Charles, en disponibilité. Le Conseil Supérieur du pouvoir Judiciaire inflige la même sanction au Doyen Raymond Jean-Michel qui est remplacé par le Juge Bernard Saint-Vil.

L’expert indépendant des Nations-Unies pour les Droits de l’Homme en Haïti a effectué quatre (4) visites pour constater la prévalence de la détention préventive prolongée, l’impunité, la situation des réfugiés et des déplacés depuis le séisme du 12 janvier 2010.

2. Instabilité Institutionnelle

On ne compte plus le nombre de commissaires du Gouvernement qui se sont succédé à la tête du Parquet de Port-au-Prince. De plus, l’Administration Générale des Douanes (AGD), la Direction Générale des Impôts (DGI), l’Unité de Lutte Contre la Corruption (ULCC), l’Unité Centrale de Renseignements Financiers (UCREF) et la Radiotélévision Nationale d’Haïti (RTNH) n’ont jamais connu autant de changement de directeurs généraux. A celà s’ajoute le nombre de ministres qui ont défilé aux ministères de l’Intérieur, du Plan, des Affaires Sociales, de la Communication, etc. Il importe de rappeler, toutefois, que quatre (4) ministres ont battu le record de longévité dans le gouvernement. Il s’agit des ministres Stéphanie Balmir Villedrouin (Tourisme), Jacques Rousseau (MTPTC), Florence Duperval Guillaume (MSPP) et Wilson Laleau (navette MEF/MCI).

3. Voyages, Accueil et Autres

Le Président Michel Martelly est parmi les présidents d’Haïti, celui qui a effectué le plus grand nombre de voyages à l’étranger et qui a reçu également le plus grand nombre de dignitaires étrangers au cours de son mandat. Il a rencontré deux (2) papes à Rome. Cette année, il a reçu la visite des présidents de la République Française et de la République de Chine (Taiwan). Le premier est venu rappeler la dette "morale" de la France envers Haïti, sans promettre ni restitution ni réparation. Le second est venu inaugurer le nouvel immeuble, logeant la Cour de Cassation de la République, offert par son pays. La Drug Enforcement Agency (DEA) des États-Unis a procédé à l’arrestation du fils de l’ex-président du Honduras Porfirio Lobo et de deux proches du président vénézuélien Nicolas Maduro.

Quelque temps auparavant, deux (2) citoyens vénézuéliens ont été appréhendés à Tabarre en possession de cinq cent mille dollars américains cash à bord de leur véhicule, par des agents de la Brigade de Lutte contre le trafic des stupéfiants (BLTS). Un trafiquant de drogue jamaïcain a été tué par balles à Baie Dumesle, Saint-Louis du Sud, suite à des échanges de tirs avec la police. De même, des ressortissants haïtiens arrêtés pour trafic de drogue et extradés aux États-Unis sont retournés au pays, après avoir purgé leur peine dans les prisons fédérales américaines. C’est le cas, par exemple, d’Oriel Jean et de Jacques Kétant. Ce dernier a bénéficié d’une réduction de peine et de la clémence de la justice américaine.

4. Violence et Insécurité

La violence et l’insécurité ont fait de nombreuses victimes cette année. De nombreux agents de la Police Nationale d’Haïti (PNH) sont tombés sous les balles de bandits circulant à moto dans la zone métropolitaine de Port-au-Prince et dans plusieurs villes de province. Selon le directeur général de la PNH, Monsieur Godson Orélus, 250.000 armes illégales seraient en circulation dans le pays. Les religieux et religieuses furent les nouvelles cibles des bandits. On a enregistré 29 attaques contre des communautés religieuses. Des milliers de fidèles catholiques ont marché dans les rues de Port-au-Prince et du Cap-Haïtien pour réclamer justice pour les religieux et religieuses.

La Commission Nationale Justice et Paix de l’Église Catholique (JILAP) a dénombré plus de 500 cas de morts par balles au cours du premier semestre de l’année 2015.

Parmi les cas les plus retentissants, citons : l’assassinat chez elle, à Vivy Mitchell de l’ex-directrice générale de la PNH sous la présidence de Jean-Bertrand Aristide, Madame Jocelyne Pierre ; l’assassinat de Oriel Jean, ancien chef de la sécurité du Palais national, sous la présidence de Jean-Bertrand Aristide ; l’attentat sur la personne de Jean Nesly Lucien, ancien directeur général de la PNH sous Jean-Bertrand Aristide, atteint de deux projectiles, tirés par des individus circulant à moto à Tabarre 36 ; l’assassinat par des individus armés de l’agronome Jean-Yves Barnatte aux Cayes, de Jean Gesner Henry Jr (dit coupé cloué jr) à Delmas 33, de Claude Delatour à Pétion-Ville, de Wickenson Bazile, employé technique du CEP et cousin du conseiller au CEP Jaccéus joseph (Droits Humains) à Delmas 32. En outre, des individus armés ont criblé de balles la résidence du conseiller au CEP Vijonet Déméro (Cultes Réformés). Á ces cas s’ajoutent toutes les violences enregistrées à Fort-Liberté, à Ouanaminthe, à Petit-Goâve, à Miragôane et à l’Arcahaie. Á Ouanaminthe, par exemple, un casque bleu chilien de la MINUSTAH a été tué. Aussi, des pays comme le Canada, les États-Unis et la France recommandent à leurs concitoyens d’éviter autant que possible de voyager en Haïti même quand un cadre supérieur de l’UNPOL déclare que la situation sécuritaire au pays n’est pas si mauvaise.

II. SUR LE PLAN ÉCONOMIQUE

Un pays que l’on disait ouvert aux affaires (open for business) trébuche à cause de l’insécurité, de la violence, de l’instabilité politique et de la mauvaise gouvernance. En début d’année fiscale 2014-2015, les prévisions économiques tablaient sur un taux de croissance du PIB de 3.5%, un taux d’inflation de 6 à 8% en rythme annuel et un taux de change oscillant entre 48 et 50 gourdes pour un dollar américain. Sans doute, ces prévisions n’avaient pas tenu compte de facteurs internes comme la sécheresse, les manifestations politiques, les grèves et de facteurs externes comme la baisse du prix du baril de pétrole sur le marché international et la raréfaction de l’aide externe à Haïti. Le brut vénézuélien, principal fournisseur de pétrole à Haïti dans le cadre de l’Accord Pétro Caribe, a perdu 61% de sa valeur en 2015. Cette baisse du prix du pétrole sur le marché international entraîne une baisse des revenus octroyés à Haïti dans le cadre de l’Accord Pétro Caribe signé avec le Venezuela. De plus, les grèves lancées par les syndicats du secteur transport, réclamant la baisse du prix du carburant à la pompe, débouchent sur une réduction des recettes fiscales. Le budget de l’exercice fiscal 2014-2015 est revu à la baisse, de 122.6 milliards à 109.5 milliards de gourdes.

La Commission Économique pour l’Amérique Latine et la Caraïbe (CEPAL) a revu à la baisse le taux de croissance économique du PIB pour Haïti à 2.5%. C’est peut-être ce qui a poussé le ministre de l’Économie et des Finances, Wilson Laleau, à déclarer l’état d’urgence économique. D’après lui, le pays vit au-dessus de ses moyens. Ce qui pourrait laisser croire que l’État allait pratiquer une politique d’austérité, en réduisant son train de vie et en éliminant les dépenses somptuaires. Le Forum Économique Mondial, dans son rapport 2015, classe Haïti 133e sur 141 pays en matière de tourisme, devant Myanmar, Burkina Faso, Mauritanie, Yémen, Mauritanie, Angola, Guinée et Tchad. Depuis quelque temps, le pays importe presque tout ce qu’il consomme et exporte très peu de biens à l’étranger. Pour la première fois dans son histoire, le pays importe du café. Moins d’un million de touristes, y compris les Haïtiens vivant à l’étranger, visitent Haïti chaque année.

Les principales sources de devises étrangères demeurent jusqu’à présent les transferts en provenance de la diaspora et l’aide internationale au développement. Les transferts en provenance de la diaspora totalisent 2 milliards de dollars américains. Avec 830 dollars américains de revenu annuel par tête d’habitants, Haïti stagne dans la classification par revenu de la Banque Mondiale. Haïti exporte pour à peine un milliard de dollars américains de biens et importe pour plus de quatre milliards de dollars américains. Le déficit de la balance commerciale se creuse davantage avec la République Dominicaine. L’Association des Industries d’Haïti (ADIH) s’inquiète de la recrudescence de la contrebande à la frontière haïtiano-dominicaine. La Cimenterie Nationale (CINA) appelle l’État haïtien à lutter contre la contrebande de ciment en provenance de la République Dominicaine. Le gouvernement estime le manque à gagner pour le fisc à près de 500 millions de dollars américains l’an. Récemment, le directeur de la douane de Malpasse se plaignait de la recrudescence de la contrebande qui se développe sur le lac Azuei.

Le rapport du Forum Économique Mondial sur la compétitivité classe Haïti 134ème sur 140 économies analysées en 2015-2016. Entre temps, la Banque Mondiale a révisé les prévisions de croissance du PIB en Haïti à la baisse, soit 1.7%. Le Congrès Américain renouvelle la Loi HOPE/HELP favorisant l’exportation de produits textiles, sans droits de douane, aux États-Unis jusqu’en 2025.

Le salaire minimum dans le secteur textile en Haïti passe à 240 gourdes par jour. Parallèlement, la gourde se déprécie fortement par rapport au dollar américain. Le taux de change de la gourde par rapport au dollar américain passe de 40 gourdes en 2011 à 52 gourdes pour un dollar américain en avril 2015. En moins de 30 jours, le taux de change est passé en mai 2015 de 46 à 56 gourdes pour un dollar américain. Le gouverneur de la Banque de la République d’Haïti (BRH) tente de rassurer et de calmer les esprits des agents économiques. La BRH intervient sur le marché pour garantir la stabilité des prix dans l’économie haïtienne. Alors, la BRH augmente les coefficients de réserve obligatoire, les taux d’intérêt sur les bons BRH et injecte des dollars américains sur le marché.

Pour les uns, la Banque Centrale réduit ainsi la capacité des banques commerciales à octroyer du crédit au secteur privé (effet d’éviction), en asséchant les liquidités disponibles dans le système bancaire. Pour d’autres, ces mesures entraînent aussi l’augmentation des taux d’intérêt sur les prêts accordés aux clients. Les coefficients de réserve obligatoire affectent même les comptes des organismes publics domiciliés dans les banques commerciales opérant en Haïti. Mais la question vitale, celle de la relance de la production nationale, seule capable de revitaliser la gourde, ne peut être adressée par la BRH uniquement mais par une nouvelle politique d’État et par un nouveau choix de société. De plus, comment ne pas provoquer inflation et chute de la gourde quand le ministère des Finances fait imprimer 14 milliards de gourdes en deux ans ?

C’est dans ce contexte économique morose que le ministère de l’Économie et des Finances (MEF) a pris un communiqué interdisant l’importation par voie terrestre de 23 produits en provenance de la République Dominicaine. Le Forum Économique du Secteur Privé jubilait. Cependant, cette décision s’apparente à une mesure protectionniste non tarifaire, susceptible dplois cuvt marchextiles,xnt l’iOganisation dondiale au Conmerci (COM). Le observateurs ce de andent àour qui Hne mesure pi lmportatte à’avpas pait i’obsjt d’én acrêtéspris un ponseil Ses ministres Sais p’én asmpli communiqué #u Cinistère de l’Édonomie et des Finances (MEF) nbsp;?

CD tout facçon les tréations dnese sont sas pait ittentde. Le Ryndicatsdes taansport,urs de la Cépublique Dominicaine.protestani et pblquanitla frontière hà Jianif Cetqui a efupour enfet d& pétnliser las uninesstextiles,opérant en Haïti.,donn l’aiprovisionsement es matière spremière s’affectué par la Brontière haïtiano-dominicaine. La Président Martelly a mdûse randre e Baihaont enrCépublique Dominicaine.prur renoontrer lon hiomlogiu WDniflo Mditna/strong> et vue de désc utr de luestion sd’intérêt sommun rux de x pary. Les ceux prosidents dignérent uneaccordéet vsx dointè. Les élhanges dommercialx et ra maigation Gont af ch#339;uv de lette dnte ne.

De rapport d«nbsp;?Dintg Bsiness)2015 ;»classe Haïti 1382me sur 1489nationa tréert risés. La Boordointion Nationale eur la cScurité dlisentairesconstate une cugmentation des trix de sproduits elisentaires. La Béprécietion de la gouvde par rapport au dollar américain psepoursuite Le rcût ee la vio cugmentae Le taux de#8217;inflation dst passé eaintiennt à l11% En mette din de#8217;année 2015. le taux de change ee la gouvde par rapport au dollar américain pvoirines 6 gourdes pour un dollar américain. SLa Banque Mentrale rBRH) tnnonçc la vinte de r5 millions de dollars aur le marché pes coanges

De r1r dctobre 2015, lesgouvernement eublia lar decret éesgBdget de l1206 milliards àe gourdes eour l’Année fiscale 2014-2016. ELes privisions de cépenses sans ce cudget dont sucport es par des paivisions de cecettes fbaées eur une rugmentation descertaine droits dt dtaxs, comme la marriceul fiscale le taibre de prsse ort, rl persis de ronduire lt ra mpae ne.< Parallèlement, lasgouvernement eadope unedecret éccordént des Nrivéilèes dexoritants,aux afcien ministres St docrétaire sd’État Ces mécisions aoulevérent la tcolre des Fyndicats duetaansport,et des Fétudants (escertaines faicltér de l’aniverseté d’HÉat d’uaïti. M Ácelle s-à s’ajouteala détciion de cirée cinq (5) "ouvelles cimmun s dolt cetle dete des prcahdns. Avrès daintie protestanions, eiolences en émaetes l l’Arcahaie. lasgouvernement eréractuaces mesures

II.. SUR LE PLAN ÉSOCIL

UL processus de vpapérieation de la Ropulation asepoursuite Su une polulation aotali de p106 millian sd’iabitants, Ha Ropulation aconomique ent eative dst entimee à l4.7millian sd’iabitants,.60% de pette dopulation ast en ghômage.

De rouvernement eaprocédé àans la clpitale e la dépmlitiqn des tmasons fans les buantie.rscompris letre la cre de la Répunon, ea cre deuCharmpde Malr et la Fre daint-LHnoreé après an procèssus de vdédmmanement dlaboieur, leassantsde vombreuses vamilies sons ltit. e plus, cls coangie.rscublics extcurés pour le plauart ear la BrrmerJu seéateur duminicaineWFélx dButiotan/strong>, esnt cfemés) En outre, des provramme.ssociéux nbsp;: lEé àPèp, TiManiianCharic, Kreé Etudants, kreé aysan, sRstanuatts hCmmunautéires, fms un placéesous lesrouvernement eLamohe, pont afrêtés aaite de linancement Pour laesrelance r lasgouvernement eu Premier Ministre Evans Paul pnmmanun nouveau cinistre deélégu auxrès de Premier Ministre chargéedes tPovramme.ssSciéux ,tPovjes pt oCangie.rscu gauvernement. /p>

Le Président Mirtelly a mrocédé à l&adistribuéion de l72autorbu à H72ajen s dgarçns des pres, lans le cadre de programme.coanges la vit charges ld métrer. El a russi lrocédé à l’anauguretion des tracéescublicqes du panadpé Vet et de Ra PNacéesaint-e- Ane, lu pané àTrimprh, lu pKioque tOccde iean ty lu pviadu de delmas des leocux deu Lyce àAlexadre létion-et du CLyce àTusséint- Luverture

La Cétciion de Tribunal dCostitutionnellduminicaine

LAl’appel eu Conlecteifeu C4décembre 2t d’autre. organisations de la société civile, cne man&festationsast erganisae à lort-au-Prince eontre la cépublique Dominicaine.< es mndividus aon tnentifieé bescencdient lesdroaeau deminicaine

L’embassadeur K’Haïti (t mépublique Dominicaine.nbsp;: SDnife Supépice /strong>, ecitsquanrl peogramme de Sumcuentation dt d’irentifiection ees timaigatts haïtiens a(PIIH) , nitif par le Jouvernement eaïtien àt mépublique Dominicaine.< I le rualifia de#8217;écohc lcisant st de faiascoaotali. "Nus lneseome.ssas en mesure d’édentifier enoscitoyens vhez eouvs",déclara --il Haïti eppellala Bépublique Dominicaine.pàga crasonsà la têibuna ee l’HEA eui aprônale diraogiu JMaalil iean tyladglore.

We Cornatal Gational eui se#8217;est darouleécette année.à lort-au-Prince eut damput d’unejour. L deux ime sour.se#8217;etait dbrsqu&ment earêtés,à cause de l’iaccde t sur enu anuCharmpde Malr ,à l’arnge de la rRe Meapis, queia baitliecousts la vit af changiur véeette "u groupe dmusial 2strong class="spip">JBaicaid Crewnbsp;: . Ce éccode t saquand lême lauseéla Rmrt due 17particuipnts,auxcoatatal Le rmardigransétait dcostarédà une mcérémoie d’éhmmanemRitenceeusesà la tmémoie des Fispoarus PEn outre, des Fstiovl des NArs de la Paraïbe ,dénombméClARIFESTA/strong>, erganisaeen Haïti pctte année, iaconnu aungrand nuccéè, tiat Mu Pointède lue de la pualité de s pect aces bua "u giveru de carticuipnion au si bien des feélégaions en Hrovenance de spays de la paraïbe (ua "u gublicshaïtiens

Cepte année, iont murts p’économiete nstrong class="spip">CenryiBazil, au hiome lonnêteset rioe st, des hangiur véeette "u groupe dmusial 2Kntg Pssesnbsp;: SAlexPierre&alias RBacékàAlex l’Adi pational nbsp;: SMax Bru oir /strong>, Maoseignemr Gierre Eaint-LHlien /strong>, Mévêua "u gDicès- de lHichen des haefmilltaire ad la MINUSTAH nbsp;: le MLietesnnt -énéral dbésil,en dJstrong class="spip">Gsé dLuiz Jarobnad, Jr l’Agronome Jierre EGaryladthiet/strong>.

We#8217;année 2015.rmaruanitlgalement le pcnte nire ad la Mremière fbcapétion du fary.partles manrnes fméricains. L10 ans pprès Haïti sst ercapé car ln frrcemméltéiationale a(INUSTAH )sous lontrôlé de spations-Unies, du dtitr deuCharpitr dVIIde la pahate de r’HENU Le rmadat du la MINUSTAH ast revouvellépour un année, iexpiett le p1 octobre 20156 Ceoïncdence distoirque, ou héissaire dméricains, enneth Merten<,sivntsdeicts la vuite à dennel au Crocessus électoral. L Entmette din d015, laïti st trouvenà une mcoisséepes coafmi . Les célections prévues le 27 décembre 2ont retnvoyés. Lour tat, lasgouvernement eadopeeun ponseil Ses mMnistres Snedecret éêébganisatt le pinistère de l&a DéfnsesJe rempoilitant les arrcem armésesd’Haïti Ue commission ens uneiatirale ent formee par la Brésidence dour évaluer la processus électoral.bancaildolt cn virreapeut-être c’Agbotiotssent es m0156 Ces alalysées pouitiques crévuoent la Cfn du cmadat du linq (ansdu Président Mirtelly al 14 mai 20116 ou hélues,xnt lemplacér unehélu

WD (uao l’aAnée 20156serai--ellesbait  ?

4ichel MSoukar/strong>

4*****/s3> />



ort-au-Prince, M22décembre 2015 /p>

La Couvelle pns uombéseannonça t le p21décembre 2u seir Ju&erl pEP Vvait aétcidéle recprt due ’écectionsprésidentiel l et des Flections liégisltive partislles crévues lour le fdianihe à7 décembre Elle yait isns doute,vuite àu coumuniqué #u presqs qu’io nouvsVvait aait iartenar Jher. /p> 4OMMUNAIQUÉ DE PRESS

p class="spip">Pout-au-Prince, Ml 149décembre 2015 /p>

LNus ,dignéaaire sd&ela présinte conditdts dàla Brésidence dnrgags dans lesprocessus électoral.bs,xnt londuire l l’anastllaiion du fouveau crésident Mélueesp7 févrer 20106,coumuniéent eapell sgGoupe de sd8 (G-8 nbsp;?:/p>

Cendatmnns féeienent dlagublicstion descerJu&erl pEnseil Slectoral.brovisiire (PEP ) appelle le sd"ésumltts duéfnitiff pour les Dlections liégisltive "alirs que le gorae pccusetions de lcrruption (pèsnt sur le membres dueSeifirencs dBreau de cCntextaeux electoral departement l d(BCED)et du CBreau du PCntextaeux electoral Gational e(BCEN. La prblicstion descer tréumltts quanett e-hit aeures dprès la tfrmation P’une rommission electoral sproc-ouvernementale ,dépmlgre lu&erl peuvoir Je rl pEP Vnt défibérésent dhoixside rersesrdans l’éecalede dt ra mpovoqction . epte avlongiriévdent .à’émplirs la vcrisepoursmilux es présente ren posstiqn desfrrcemmans de cnégoiations douitiques cventiulles cimnrrmerJàquelqPointèd’Edat alperdu 6d sa vspervb et de lon prostioe avec la peuvoir JTèt-kle et de cadacture sarviee d’HnejEP Vscélral souvmi aux clprèies de d’Edtcuréif

We CG-8dcoit du’il cns undivpenséble dajours’éhuid’arcordée une pootectionncarticuulère fux aénonciatiurs ex aux atéoins de pccer de scrruption (olt cs 2ont retnus cirpeales des bembres due cBCEDet du CBCEN axnt l& Crblicstion des césumltts La ponidur la peéventivn et ca crpurssion de pccer de scrruption (ersit d’aucordée uneeuatiu darticuulèrsà lcux eueiavule t lonpérar pour lersit trsà la tustice pdebaitreulalauière fsurde pccer de scrruption (mpliquant de sÉugem dlectoral dt ce l&s césrimer 1vec la Rerniere réigueu. El a’est pas snrmateJu&erl pEetre desTabalation a(CTV) ces mBCEDet desgBCEN,par la BratiquerMu Poit-de-vi as csubtitutsn aux alectours

We CG-8dapui eles manifestations polulatre sdacitfques onganisae an prfupoa out càtravars H& pays iour frrcemrd’EdtcuréifJe rl pEP Vàmestect r la pvrdisc de sÉunes

We CG-8decomnnaî au poruli caïtien àaedroit diégiime làga crévloeeun pve d’Hexigr la peparte ntircip d’unejeuvoir JkleptocatiquerMui se#8217;eéoate de céèges dépmocatiquer de gostion de l’Élat /p>

Polu pqe jamaïs dUniJe rolideire, le gG-8decouvelle ps cvlongirde lout cetre lendre lans le cadre deeulalai, eour fritreuestect r la cvlongirdolulatre

Pour lesgG-8nbsp;?:/p>

Cstrong class="spip">SoamelqPMADISTIN/strong>< s/br>
/>



ort-au-Prince, M11décembre 2015 s/br>
L revu e#u presqs qrésentee drcibrovisnt de ll Direction Gationale d&u Lire l(DNL) cesCinistère de l’ÉEonomie et des Finances, Wervice Métropolitain de Collecte des Résidus Solides (SMCRS) es daudCostil SEectoral GPovisiire (PEP ) El aymanque àeut-être cn prfupousidu#8217;estritsecitsquae,Sais pc 2ont ruand lême les indrrmation sà prèndre lencomptes

4Dns la cresqs qationale /strong>

Lstrong class="spip"> ÉPuitiques/SEectoon s/i> &/p>

Weos de#8217;Hne rénoontrerpc 2mardigvec le sÉuurnilise e, e’arnien chnditdtsau pSéat paur le fdpartement de r’HEesti,SArelldélizaire.,se#8217;est dlâchénbsp;: u«nbsp;?Jeàvurde s de andenr àJean Gertrand Aristide, Mans luelqPcrmpdt trouvenàsnncarticnbsp;;».Il a rencoaricnbsp;: u«nbsp;?Jeàe andenà dAistideGFanmiLa vleds/strong> et vue de doursuitre lnore c&ute dopr la pépmocatiqenbsp;;».IL#8217;arnien cprlesentairesce ll D49eliégisltire foit dce appel dens lesput de mesnrrcemrd& Rmrilitanion Gàtravars H& pres, ltnditsque la sommunautésinternationale aente de ralmer leaaention dain de#8217;aviter aout fuptire fvec lette dtndante pdpmocatiquergrand ssants en Haïti .MSoucemnbsp;: Ésonpéfmhit i.omm /i> /p>

We Ccordonnantmr Genneth Merten rente nmelt
E Haïti pepuis le sjeudig3décembre , enneth MertenJocvnel NMoïs
&at RJde DClectid r(ais pchacneeupartsent ) cesCpésident Mirtelly #82130;tc. Iais lren c’avpve sent daanspoié deucer trnoontrer. LWashingtn mantrerpinsi lsafrrcem Il ent vee sque le uis quel enneth MertenÉhit ienarchée.omm/i> /p>

Winaie H& paudiion sàaugBCEN,pls césumltts duéfnitiff pn astentae
LeCBreau du Pcntextaeux electoral Gational e(BCEN.a béouclri’oaudiion ae r’Htnsmbre le sdas sui ont dté couvmi aààsnncexaent La première fchabre 2uCrbdnte nde les me nier sdossiers dnoone pancdats d&ns la cnut daudludit 7décembre 2015 Austerre de Sc paudiion s le taibunal dlectoral Gational e vitdesu potalide S95decomur sui oyont dté cxercé s Pour la#8217;anastlt, loutes les vomptsstiqn asnt ce train de véfibérér lor le meifirencs dossiers dnottnus ,indrrma la conteillere flectoral sstrong class="spip"> , Membresad la Mremière fchabre 2u CBCEN.MSoucemnbsp;: Ée ttional .ht/i> /p>

WEectoon snbsp;: (osic) /i> /br> Leconteilldlectoral Ga#8217;emtrnd uléenrni rax prossion sd&ela pre di rax pppel due cscteurs gui oéclamern ra maisedn placées’une rommission e’emtqutesendépendante Laos de#8217;Hne rimnrérnce de lpesse, lce 7décembre ,des bembres duupEP Vnt doit dtat d&esVvaices edéjàeffectué eset vue deusecond etur le f7 décembre 2rochein. SAx ppteurs gouitiques cui sellecit nt, làtravars H& pméiasp ou hecprt due ette déat, des EP Vs#8217;est dat ouvert aais pouvhit une bdpmrchéeinstatutionnelle<.MSoucemnbsp;: Émeropoliehit i.omm/i> /p>

Ws class="spip">ÉSoniété /strong> r/i> /p>

Wea2strong class="spip">JBID/strong>&alcordéel22millions dour friiliéer la#8217;afcéè,l l’aau dpoablae/br> L Direction Gationale d& l’ÉEu croablaedt ce l’aAséintotssent e(DINEP) desvait laicem d&ns les prichein. moti due cpovjes pvtant làmesnrrcemrd& Rroduction nd#8217;aau dpoablaeàans la crpgon nétropolitaine de Port-au-Prince Ces apénuies dnt dté cxregistrées àousidfréu&meent ea cours de me nier sdoti dn réasonsànorammnt de ll Dvétstérdeusésinau De soeprésextant sd&ela panque MIterdméricaine.des Dveloppement.e(BID) nt sasraphéJher.avec la pouvernement eaïtien àneaccordéeéel22millions de dollars arur renorrcemrd& secteur td la Mreduction nd#8217;aau dpoablae.Les privjes psernt donanceé cimnjintèment par ra paIDet l’aAence éEspagnoe d& lCnpéranion GIternationale DSoucemnbsp;: Émeropoliehit i.omm/i> /p>

WUe cmoriu Un tout fremière fans cnorerpistoire, le contetrction nd#8217;aue cmoriu GForence Duperval Guillaume /strong>, anlrocédé en paésinte ae Ra PNemière fanm de la gépublique, ostrong class="spip">SonphiaMirtelly /strong>, a la pomssad la Mremière fperre EescerJbâtient qui se eapricgéeur une rspervicienévalueénà unecadarru de cerres.àTussles pntervinunt sdà ette dcérémoie dnt sasrl d’unejmoent eastoirque, od#8217;aue cmoriu É /p>

Ws class="spip">ÉSEuctteon /strong> r/i> /p>

Waïti -Éuctteon nbsp;: <4(ansdu PrSUGOln ghôifie s /br> Lecirecteur général deuministère de l’Écuctteon SRénoed Telorte/strong>, anlrosenteea la poesse, les2mardig8décembre ,da rapport du quatre mnnée. déela paisedn p#339;uvve 2u CPogramme de SSolasitation duiverselle, àgatiite àt obligatoire a(rSUGO) iaconntatié Hit iPNemss Network.crésinteeaous lrrma ld Sumcuentaghôifieéconcirnanc l’aastoirque,de lpacmentsde écones nouncublicqes dmpliquae. déns lespstrong class="spip">JiSUGO/strong> rans ceaque adpartement de pays, ai s’agit as on le directeur gRénoed Telorte od#8217;auedtat d&esVleux ee programme.cde2011 à 5015 AQustion de laanspoarnce, dunexempleiresceuSumcuentagdéjàeisponiblesrans ceaqcun des Fisrctions lepartement lls duupinistère ,a été temiè pcx aembres dueSa poesse,.MSoucemnbsp;: Éhpnhit i.omm/i> /p>

WLecnuérique Lu secvice MueSa prrmation P&e dn eignent s /br> Tusjurs dens la csmplierne le logeque,de l«nbsp;?réinvnte rel système béuctteofnbsp;;»,directeur de#8217;Héablaotssent ,indtect rrs, lpéraniurs de ltéléphoie dmrilie#82130;cs 2ont repunosles manrdig8dt rircéredig9décembre 2u xdona dueSeic utr ,parlaber et denvtange une pnpte anprovprition , artles mn eignent s,des bouveau xoutrllsde les aoport unoé pe#8217;ananoateon dpédaggeque,dffert e.partlescnuérique sous la phulevte "u ginistère de l’Écuctteon Jmbassadeude Rrance rn Haïti /strong>&at JEetre dnternational ee#8217;Héauue cpédaggeque,s/strong> e(CIP ) ESoucemnbsp;: Ée tuvellese e.omm /i> /p>

Ws class="spip">ÉSulteue&a/i> /p>

Waïti -USA-ulteueÉhpnhit i.omm/i> /p>

Wstrong class="spip">4Dns la cresqs qnternationale /strong>&/p>

WSnundor soepvtanría va Plíneadisisiiritcimn Hit í
El Snundoprfireá l GPoenrnEjeuréivooepaizai uneaoepvtaiónexehustéivadeeulalaíneadisisiiritcue,de imineala drontiee enrre la cstrong class="spip">SRepúlicstDominicaina/strong> eyla cstrong class="spip">SRepúlicstDd Haïtií/strong>. CPrm alidmoéivoo& Coumtaióned HAsuntosRrantieeizo quel resqieeulalsnundor cstrong class="spip">SSoieaMirteo/strong>, andrrmaóquel rncdieáindrrma lavorible dala cresoluciónede ilsnundorcstrong class="spip">SSAdrano- Sánhez eRoa/strong>&a/itrong>. CL cresolucióneien rommodonanideidvirrciect etl cuepiminnrrodonl dee 2strong class="spip">JTanindoprantieeizoDominicao-Hit ino- del1929/strong> eylsupstrong class="spip">Jirotoone- delRpvtaiónedel1936/itrong>. CE va Pperz le gisltivealsntusticiectla crevtaiónexnetl cns ieeand ocerrirnoundivcnd ocue Dt Ses ontrôlas ocycreuients lalsjumaigatiiriocyct Sincrment osoue enidodeeula relatconas vomprciales onrre lRepúlicstDominicainacycHaïtií,Saïnmpovoqctdoo& Coapétcióneiresularide cerreiiirioceminicaio- ortpoa o Eesceiueidanoschit ino-s.MSoucemnbsp;: Éese ndivsito.omm/i> /p>

WHit i La Béaspora trovpoe des rsoluions polr.seurt td la Mcriseplectoral spationale /br> Pusieurs vrganisations deprésextant l&adisspora taïtienne.pux États-Unis js 2ont repunos lour lrouvenrdes rsoluions pàla Mcriseplectoral spn Haïti .MParami lles ct trouvenc l’aAliarce dour él lReouveau c’Haïti (BHRA),la pahabre 2aïtienne.pd commerci dméricains a(HACCOF),l’aAliarce dationale aour ra Mredmoéin des tridfssion ell haïtiens a(PNSAA),lKonbitpour Haïti ,rl pEnsrès Aour frrcifier eaïti ss l’iOganisation dationale aour ra Mredmoéin des taïti,ns ,sui se dantrern prêébcapé e.partle#8217;anmétctss l’inmétss conteenunlor le#8217;économie ,da miégiimetaéen l&adtabilité de couvernement otsuee progèssus de vvot,.MSoucemnbsp;: Éadacibcrmlencews.omm/i>

Wsi> /p>

Wstrong class="spip">4Le exte ée pjur /p> 46 gourdes pour un dollar nbsp;: un aconomie hmiriboid,ittentdlescnuveau cpésident M es mndée lour le fdveloppement./h3> p class="spip">Poarcstrong class="spip">SThoas 3Llisen/strong>< sbr>

WSoucemnbsp;: s class="spip">É /p>

WLecaite ul drésidentiel emeurenle#8217;éu des troses les vousidonovooé pn Haïti .Mes m54conditdts dàla Bpésidence dagréé.partlescEnseil Slectoral.brovisiire (PEP ) our lerticuipl au Cromier Mtur ,desx pptenndirnt d& sectnd etur le l’Écectionsprésidentiel l Ce qui panque àcpendant, cet2ont res tridtsstiqn aoncirèer de souitiques crblicqes dolr.seurt t& pays iu cmarasm économique matué . /p>

<Éections loulaanspiion , n aconomie hmiriboid,ittentdlescnuveau cpésident Me la gépublique, La Bérniere rnot,dur la pelitique dantéairesce ll Danque de la République d’Haïti (BRH) ,cimuvrnt l& Crricod,itlant edntuslle làmseptmbre 2015 ,lneseoufie d’autcun dabrigüié. Dlle yimnrrmernbsp;: u«nbsp;?A cours deuquatreime stimertre de l’Éxercice fiscal 2014-2015 le contjnciire fconomique maété tmaruae par ln frrcteBéprécietion de la gmnnanie

We Cv nde dif7 douvmbre 2015 ,le#8217;éu des Fi x pausidrand e banques commerciales od la Mcpitale eaïtienne.pv ndit la biele lert aà 59gourdes ps les

WOn omnnaî adéjàe&acoangsn nbsp;:

LSiles pntervinuions de la sBnque àcptrale rvaitrn prrsis de rrmern rel saux de change eutorr de l2 gourdes p la tmi-septmbre 2ontrerp55.2 gourdes pour un dollar amuyébut iu cmti dueluslle l015 ,lrrcemmst plirs qdsconstatee ln frrcteBepréie desla Mdcont de la gourde c me nier sdjurs Depuis qa Cfn du cmos p’éctobre le cbnque àcmmerciale scidessuu maenionneé.pv ndit la biele lert aà 55,5gourdes pour u&s mottant sdonpris letre l2500 m l10 00 aollars américains. /p>

Wea2RH usee enrone pbligae.à’éntervinuirdur le marché pt vundant,des Fillars amirs que lls césurvinsqnternationale spnpte sétaitnt Mrduit s p leule ent 822,1millions de dollars américains lmuy23(septmbre 2015 ALs pntervinuions de la sBH usr le marché pes coanges d’auril 2àlusl d015,rvaitrn pontrôibué,letre lutres, càdne baisse des césurvinsqnternationale spnpte séueia aitrn potaliseé 858,9millions dmuy17lusl d015,rontrerp921,7millions de dollars aneetimertre dausidtô /p>

PFutr-l 2eppellsrque#8217;emt(septmbre 20152,lls césurvinsqnpte sés#8217;Écecaitrn pà 1,3milliard de dollars américains CE vtoissgans,alles cut ednciddmetné #u p477,9millions de dollars américains soit 1ne baisse desl37nbsp;:% La BRH iy uis ee enrone pour enssayl ae rcntextr la souvelle pdcont de la gourde bservaé c me nier sdjurs DJsqu’eàruand nbsp;?

Wea2not,dur la pelitique dantéairescoursuitenbsp;: u«nbsp;?A civeru de sfrnancem crblicqes Ha Rortistance du Pdéséueilire 2udgeéairesc Mdcéouchéeur unelinancement dantéairescoiche de l11milliards de gourdes . O Gacgalement lbservaéune pootrassion donteenunle la gbas dantéaires Dlle y ee t itteôibullaed la thusts deusetockdu crédit an làm’État har rapport au drecu Ses mvoirs dnxérêeurs an .nbsp;;»/p>

Le soepettes frblicqes dn Hbisse
Cntrecireent ea carché peocul,usr le marché pnternationale, n Gaconntatié lu ett le ptimertre duslle -septmbre 2015 ,lun dabéionraion de l’aicivité cconomique.et des Ffables daux de#8217;inflation ,carticuulère msn aux atats-Unis je#8217;Arérique .Les prix de sproduits edegbas dnt rbisseé lydonpris les vomrs deuqptropae.Lesdroduitssntérêeursobrsta(PIB)américain ps#8217;est pccré anuCtoissime stimertre d015,rà 3,7nbsp;:%dn Hgaotssent mnnéuel après an echntrection de l0,7nbsp;:%da cours deuqtimertre datérêeurs Ce a Mous -entdlue la soroseté cconomique.ebservaé sr le mpla dationalesst da#8217;uirde dnterna

La Caisse des crix dmndialx po#8217;avpar dnmpêhé pne polusséepesl’Énflation esr le marché peocullu ett le#8217;Éxercice fiscal 2conulé CE vgaotssent mnnéuel ao dst passé ee l2,8nbsp;:%dn Hctobre 20154rà 6,4nbsp;:%dn Hmlr ,àuis qe l10,4nbsp;:%dn Haût e l11,3nbsp;:%dn Hseptmbre 2015 ALs putorroé pnxliquarn poerencoarictssent mes crix dar la Brables e desla Mrconetenagrionesee prontèmes, lprturebe par les condiaiqn aolimaiques edéivorible ssans ce taines frpgon snagriones et la FrrcteBéprécietion de la gouvde Ce ale-ciMrduit nesceuvoir J’aucht du#8217;éu dopulation aueia sista ,duelanifre rimuis ants càdne bollarssation dcoisssnte ee re#8217;économie

WRppellos lue l&adisponibllité dlisentairesclcalesast pcsuure eour lpus td da sortif par le s mportation spays eset vollars américains Cepte amportation pm sisv ciréeune poossion donttanct dur la pe andenàe dollars aaitant linsi lgrimp rel saux de change . oarcille rs, la cours deuq4 stimertre de l’Énnée fiscale 2014-2015 le soepettes frblicqes dut edmetné #u p5nbsp;:%dn Hgaotssent mtimertreiel an cprsantsde v13,5gilliards de gourdes e l12,0 milliards de gourdes Le tatalide soepettes fmuy23(septmbre 2 aitrn potaliseé 54,7milliords de gourdes soit 1nesaux de créaltation de l88,4nbsp;:%dar rapport au xpaivisions dudgeéaires. /p>

Wea2Rnque àcptrale rvyimnrrmeéune pootrassion dtimertreiele d& l3.7nbsp;:%de la gmnnanie

Wea2not,dur la pelitique dantéairesce la sBH uoit duand lême létt du#8217;éu dlégre fuxmentation descertaine dscteurs ge l’aicivité cconomique.ear rapport au dtimertre daril -usl d015,.Paraexemplee,l’Énfdce MueSa preduction ninus reiele d(IPI es dceluige l’aicivité ccmmerciale sesvaitrn poroîre de l1,9nbsp;:%dnt 4,7nbsp;:%da cours deuqe nier stimertre de l’Éxercice fiscal 2014-2015 .àAincga creréie deslertaine doangie.rs,d& secteur td la Montetrction ndsvait lrerouvenrda Mcrisssnte Mprès aaoir Jeregistréean echntrection dnuCtoissime stimertre

WMis pc vertt s pmbrlles de eurent mtiopFfables dour lrirs la vcrisssnte Mconomique.ears H& phust La BRH irévuoe 1nesale niotssent eeuqtux de chrisssnte Mconomique.eliea la paisse des cépenses sa#8217;Énfvstiotssent cublics e dàva Pontrer-ervirmatce du Pecteur tagriones Clle y #8217;aitentdlàcerJu&erl seffec sd&ela pscohcesqs qn Haïti pe es mépublique Ddminicaine.ps

Lens lnesatl cnsexte ,andivquele cbnque àe banques Ha Ropsire fu la Mppitique dantéairescvs ee ea soeuraletation de la#8217;anmétctsu la Miqueiitaéenxléent irescur la pe andenàe doevtae,dans l’économie duelanifre ràlemetar les effec sd&ela ptanspission e& da Mdcrécietion de la gmnnanie

LAec la pouvres uto dlectoral dui panrue rnt d& sromier Mssenstr deuCrésent lnercice fiscal ao de bolt iar d #8217;aitentdrnà une micivité cconomique.eflorsssnte epur la#8217;axercice fiscal 2014-2016.
/>

Nuvmbre 2015 s/br>
Ds nouveales des blections Ue crrma ld Ssimlatcr,dffecienlsatl u’il cns ucngirdor la Bevu e#u presqs qrédtsse par la Ritue C3Goupenbsp;?< s/br>
strong class="spip">4Dns la cresqs qationale /strong>

Lstrong class="spip"> ÉPuitiques/SEectoon s/i> &/p>

WSteenc Benoî aurassié,d& sSéat pcndatmne/p>

We#8217;anrassion dur la personne Ju seéateur dnrCanciion et chnditdtsaàla Bpésidence dstrong class="spip">SSteenc IvinuonsàBenoî /strong>&at 4ioie dean -ahatl,s/strong> eset du qpésexte éu pSéat pe doi aembres dpur.se#8217;exteriresce ls ptorpurs CTnditsque#8217;il cs#8217;est penu céloignécu Pdébt pauitique d& uis qnecartainetemps, largrand ICmrpsensssourt ldnàsnncmtiotmscerJjeudigpur.seeposstiqn nr lor le contjnciire fdmmnée eor la Buestion vlectoral spn pcndatmne la Bepurssion de panifestations pe la#8217;aoporstiqn dar la Broice eationale Soucemnbsp;: Ée tuvellese e.ommsi> /p>

Wstrong class="spip">4Éaïti -Éectoon snbsp;: &/p>

WUnàsnndag de la#8217;aIstatutidbésil,en dstrong class="spip">4Iaranp /strong> rmlgre lu&erl césumltts dpésemetntre sdffecienlsee re#8217;écectionsprésidentiel l eu P2 octobre 2e nier sn Haïti pour a trn pe pas preflé r la cvlongirdes blecti rs, laprèndrl’Agrnce dnrlemnerps class="spip">ÉAatr Nemsse/i> .IL#8217;amtqutesebasé fsurde petre eens avec lluside l1.80 atlcteurs ge l135àcptrae de vvot,dans l’éensmbre le sdoi aepartement sd’Haïti crévèl cn pschéandesvvot,dtès aeifirencsdeslerluige césumltts dffecienlseplnçnt de trêt pesphnditdtsau Poivoir ostrong class="spip">Socvnel NMois&. 37,5nbsp;:%de petquteé dut endivqu laoir Jvotépour ustrong class="spip">RJde DClectid rdupoa oi Ligue alernatiov dour él lootraèsdt ce#8217;écatceipnion aaïtienne.p(strong class="spip">4Lape /strong>,), 30,6%dispnt pveir Jvotépour ustrong class="spip">Rioie dean ahatl,s/strong> eu la Mpatierrma lstrong class="spip">JieatuMes slet /strong>, M19,4%pour ustrong class="spip">Riarye dNacicss&ad lstrong class="spip">JFanmiLa vleds/strong> . ocvnel NMoïs<2u CPa oi hit ien tèt kle e(Phtk) la coivoir oaété thoixsideule ent ar l6,3%ge céspodante duel’Éxtqutes Soucemnbsp;: Éalernoesse,.orgsi> /p>

W[Rppellos lue#8217;éu dartainetomiresad londitdts dpotntiel see phustciveru d aitrn pdéjàeté cxmpêhé duelseprésente rear le Jouvoir Jaxnt letpancdatspe doéut de ma pcrmpgner]/p>

Ws class="spip">ÉSFanmiLa vledsoaéaintienulespmo da#8217;uirde dd man&festationsau P20Rouvmbre /strong>&a/i> /p>

WGLois qGral d Glle ,/strong>&aait isnvir Ju&erette dmrchéeioa oieapdu Brulevrd dean Jacues ces slet s et lppelle la Mppulation làmespodareune pouvelle pfti dn rmtss cà ette dcnovoction . Soucemnbsp;: Éahphit i.orgsi> /p>

Ws class="spip">ÉSLechnditdtsaàla Bpésidence du CPHTKpt vuiste à dort-ade-Paix,lsepréoonçc eontre la crrmation P&ela rommission endépendante ee rericiection /strong> r/i> /p>

Weechnditdtsaàla Bpésidence du CPa oi Hit ien Tèt Kle docvnel NMois< oaéffectué cerJjeudigne puiste à dort-ade-Paix oùli a creorcic les pitoyens vui ont dvotépn Hs Bravur dirs qdsca presidentiel l eu P2 oOtobre .Il ennanlrocfitépour us#8217;estre enuirgvec le sÉleu CPHTKpans la crpgon . M.nbsp;;ioie dlass=é 1r ,ps on le césumltts dpésemetntre sdueSa presidentiel l eu P2 octobre ,se#8217;est dréoonçcélàm’Ébcasion deontre la crrmation P&ela rommission endépendante ee rericiection crélamee par ln fdzairnsad londitdts dàla Bpésidence oargant du&erl pecret électoral Gaeirévuoe 1as poarnlle dopmrchée DSoucemnbsp;: Éahphit i.orgsi> /p>

Ws class="spip">ÉSLecBCEN atorros ll Dvéiciection ca coetre desTtbalation /strong> r/i> /p>

Weecaibunal dlectoral Gamespodaulavorible mrn pà a Bevqutesees Fi x paa oi gouitiques cui son pontretérdls césumltts dueSa presidentiel l et dn Gamatorrosean ecvéiciection ca civeru de coetre desTtbalation Ce qn#8217;est drr dnoone pl pvrdisc deu breau du Pcntextaeux electoral Gational eais pdns lneul«nbsp;?étciion daxnt l&ie lroit nbsp;;»,despstrong class="spip">JBCEN/strong>&alprrsis dn ecvéiciection ca civeru de coetre desTtbalation CALs pi x paa oi gouitiques cayan pontretérdls césumltts dpésemetntre sdue Dlections lresidentiel l , càdsnvir JFanmiLa vledsod Malrye dNacicssJVllauie lCluny Duroinaux/strong>, ert dté cinvoé perJjeudignuChTVpour uvéicier les erichès-vrdbaux DSoucemnbsp;: Émeropoliehit i.omm/i> /p>

Wstrong class="spip">4Ées conditdts dàla Bpésidence depunoslu secn du cgoupe de sd8 mtrnd nt paur uitre ll Rmrilitanion Gacitfquestustu’eàrouvell irde /i> &/p>

WQustion de lanteenunrde#8217;extigr luupEP Vluside laanspoarnce,dans lesprocessus électoral..ICmdatmnan péeienent dle obrstlité proiceeèes dontre la panifestatte duurircéredig18Rouvmbre ,à dort-au-Prince, Mc paspiett coaff duel’État hénoncinc l’a ttiauueau Poivoir cui ,ps on lur, lnsssor él lointède laitreun nuangegouitiquesent mnbusiffu la Mppite eationale Lbérétion aot lppaès-midiees Fi x pilltait sd&ela ppatierrma lieatuMes slet parrteé dnuChap-Hïtien àaed5Rouvmbre ea nier .lstrong class="spip">JGesne lean Gfferrd /strong>&at RMuler Julmse e/strong>&alaitrn pté tcppéshnd preudprès la trblicstion des césumltts dpésemetntre sdueSa presidentiel l eu P2 octobre et lpcuse dueltntatiov.à’éntcncdis Soucemnbsp;: Éradiot leisions2000.omm/i> /p>

Wstrong class="spip">4eecGuvernement epuruvenàa pvilencc pochéetrées àirs qds me nieèes danifestations /strong>&/p>

WeecGuvernement d la République d’Haïti (it aonstatee lvec lbnauirpeJ’auppéshndion, cue àe banifestations pnganisae aour uantente r ls césumltts due me nieèes dlections ,doevtnne.t d llus dn palu pvilenc e, ee pe pestect rt sas pes noumes drpgosantsdeaaentu dd man&festationssdacitfques . (#82130;)Tut cetdecomnnaosantsde remtect tt le proit dd man&festa rearitfquesmet, lasgouvernement eepuruvenàa pomiresx clp de vvilencc cadacturict pn egistréesmans de can&festationssdus ceptiles des it trsàn paéil 2c qui pente n&ela psuvernirnsé tationale ae pays,.MSoucemnbsp;: Ésigmalfmhit i.ommsi> /p>

Ws class="spip">ÉSLe doangceler sdaïtien àttodminicaineps r/i> /p>

Weecmaiistre daïtien àe cAfftre sdéaansgre s ostrong class="spip">SLrn reRenauld/strong>, emt don dehomologue odminicaine emstrong class="spip">SAdaresmNlairro/strong>, advontps É /p>

Wstrong class="spip"> ÉPp de vrand e bestaivté pror la pbaairle d& lVe oire s/i> &/p>

We p212 menénnoverseiresce la sbaairle d& lVe oire s,cayan pontuit n l’anaépendantc d’Haïti oaété thmmiémorea la pclche de lbos le sircéredig18Rouvmbre 2015 .MSeulle siiistre de sduort s ostrong class="spip">SJimey Albete/strong>, as#8217;Éctit lredaulnuChaptaïti,nsdain deelerticuipl aàdne barèv dcérémoie de lea2iémoie de sdhéroide la#8217;anaépendantc Le tiiistre dAlbetepdns lneularèv dallchuion de l3milntes laeapell n l’aunoé enrre lae bellsd’Haïti DÁ ette dbcasion du mas slgeirévJeregistréeae coaffduel’État hvait até teifise .MSoucemnbsp;: Émeropoliehit i.omm/i> /p>

Wstrong class="spip"> ÉRisue d& dcriseplisentairescdns l6aepartement sd& pays,/i> &/p>

WS on lea2CNSA,les vomdiaiqn auelsécurté dlisentairescn sesvaitrn par d #8217;aibéionrm d&ns llusieurs vepartement sd& pays, Le tdéiciet2hydique Ludnrg nderdes bprt e.pagriones ed llus dd l50nbsp;:%dar rapport aàla pcrmpgnerpagrioneseatérêeurs Le te nier sapport du qea2Cordointion dationale au qea2Sécurté dlisentairesc(CNSA),trblicé ette dsearine,lor le#8217;écvoluionsn&ela psécurté dlisentairescrévuoe 1nerpagoraetion de la#8217;annsécurté dlisentairescans deversevepartement sdd& pays, LEneffec lasgNrdo lasgNrdo-Es lasgNrdo-Eesti,Ée ttional .ht/i> /p>

Wstrong class="spip"> Dns la cresqs qnternationale /strong>& s/br>
strong class="spip">4ÉEtecand ontrôlas etl cólee enr Hit í/i>
&/p>

WElqnterrande n&ela pirectciónegrn rlide Ses irrollcprantieeizoDnr Hit í, Max AntornsaII oaseguró ayl aquele putorrodae sdhit inor dnolonpé rlciónecn endtatutconas vnternatconale spe SSaludpPúlicst lnssá potmnd oceods pea temitdtsscrrueponidents poaradispilntr lao lrensgo ly curarcipea tersonna lue lien n cólee enr s i nlción. #82120;Etecanmo quel muydréoot- ordnmo qetabilitza la vuntulcióneuel no qetaádaict ttdoremtect o l Gcólee LEte ne lnesatandesvds irrollc,Saïylue lenr má trosbllitdae sdoaradao lreidentiesDnr Hit í, rédtsrconal taguadpoablae,creuarvomdiaconas vhumnor ,doaradquele cgntaslpued vitvr Jerune ambents lsid ontraetntconas #82121;,can&festaó.MSoucemnbsp;: Éese ndivsito.omm /i> s/br>

s class="spip">ÉSaïti -Éectoon snbsp;: r/i> Un tmn&festationsau llusieurs villioes qdscersonne .,dcnovouae par la#8217;aoporstiqn daur réclamer ln acaluetion dndépendante ee césumltts dueSa presidentiel l eu P2 octobre 2e nier oaété tvilenment nivpenrse eor la Bppite eins l’éppaès-midieeug18Rouvmbre 2015 pà Péion vrle d(rricparicsast ) EPusieurs versonne .ert dté cles eé .,donn laupoins de x clpditdts dàla Bpésidence oa Riéateur dSteenc Benoitss l’irnien ciéateur dean -ahatl,sNMois< oirs quele cppite ealrir de coaz atcrymogèn.et des Fbales onrclpoutchouc,amirs que lls canifestatte dlaitnt Mor inus de vtt le psiègeee pEnseil Slectoral.brovisiire (PEep) ESoucemnbsp;: Éalernoesse,.orgsi>
br> strong class="spip">4ÉD sdéauivste duel’ÉUEHse danilitant paur lesJestect au Pvot dopulatres/i>
&/p>

WEnàsnui,nsda Pv n dd marilitanion Gbcapétt le pbétnsau uis quellues cjurs dontre la pésumltts dprticnlsee re presidentiel l ,llusieurs vezairns de#8217;Héauivste ds crélameatspe d’aunoerseté de#8217;État hé#8217;Haïti (BUEH) nt sanifesta cerJircéredig18Rouvmbre 2015 ,d&ns les prer de gort-au-Prince, Mour entigr ,rux eusts ,rl pestect au Pvrdisc dopulatrescans le cadre dee Dlections liégisltiivs et lresidentiel l eu P2 octobre 2015 ,daconntatié Hiï iPNemss Network.cSoucemnbsp;: Éhpnhit i.omm/i> /p>

Wstrong class="spip">4ÉDzairns deevillioes qdscersonne .d&ns les prer derJ18Rouvmbre /i> &/p>

WDe vezairns deevillioes qdscersonne .dnt sgagnéces prer derJircéredig18Rouvmbre 2ans le cadre deeui x pin&festationssdnnonçcée ,pour lrélamer le Jestect au Pvot dmajrroéare, lurte àu xcésumltts dueSa presidentiel l eu P2 octobre ,splnçnt desphnditdtsau PPa oi ffecienlsPHTKpt vremière fprstiqn .PPa oi de vtt le prerns deeve#8217;écgaot SStlean Bosco2ans le cqurticnrdopulatrescaeÉahphit i.orgsi> /p>

Wstrong class="spip">4ÉTabdarrnbsp;: &/p>

We trblicstion des césumltts dpésemetntre sdue Dlections lmunoeipnis àiudit sir Jadbcasion nrdes brouvle ssans clusieurs v ndeoi sd&ela pcritale eaïtienne. Cep césumltts dsmbre n pe#8217;atre car dbentinus dour u&s mhbilait sd&ela pommunaeBéplTabdarrat dne bprticnd&ela ppatie Ju sCulade-pSlcànorammnt Cep ce nier sdnt sanifesta ce rs mécntextament d leifirencss canifèes danrdigation LTièidtô perJjur -là let2n#8217;Éctit lar dne bprticnd&elpatisirpaur les Driernirn dui pfréu&mtextace taines frtièe sdueSette dvrle Soucemnbsp;: Ée tuvellese e.ommsi> /p>

Wstrong class="spip">4Euctteon /strong>
s class="spip">ÉSL#8217;uUnoerseté dQuisue yatvathmmiémorr Mso Husili de#8217;Élrgent/strong> r/i> /p>

WPor le conmiémortion des c2 onnée. déela#8217;uUnoerseté dstrong class="spip">SQuisue ya/strong>, asotdecoeur tadonnnéces tn aotdanrdignuChetre desTonteivateon de sdbens aclteueSJacky Luanrue /strong> rndivquelout césgouJu&erette dremière fmn&festationsaaee esiplee,l ns drambor lnibroumptte .l«nbsp;?J#8217;Élid& secntient quielême leeaccoep tt le prontuipldéela#8217;unnée fusiliare, li a’eym eas peeurdéelusilir .lNigpur.souvsn l’aunoerseté .lNigpur.saïti Nigpur.se Jesttldéela#8217;uhumnoté nbsp;;»,dapnxliquaése Jesoeur ,daxnt l& laitreun nurevoide soeversep césletation sdueSette dnstatutionnl& larmation Pspérieers aa cours de secsdremière c2 onnée. Soucemnbsp;: Ée tuvellese e.ommsi> /p>

Wstrong class="spip">4Dns la cresqs qnternationale /strong>& sbr> strong class="spip">4Éaïti nbsp;: &/p>

We tmn&festationsau la#8217;aoporstiqn u cpésident MMichl NMctelly ps#8217;est pccheaé ircéredig18Rouvmbre 2ans le Crn&fuesnbsp;: Érfi.frsi>

/>


Jslle l015 /p>

WNuvsnrblicn sdncidne bpre eudassié par la RColectiof Hit iPrance r ot 4Colectiof Hit iPd Rrance sbr> strong class="spip">4UNE SEMAINE EN HAÏTI/strong>& sbr> L#8217;uhebdomadare,ee pEnlectiof Hiï iPd Rrance sbr> Un trédction de#8217;ÉAlernoesse, #82130;avec la psnui,nsdesma gFokal sbr> N°1195 | 01luslle l015 /h3> p class="spip">Psbr> LES TITRES DE LA SEMAINE N°1195/p>

WMirhe de lsoitdarté dà Ouanamnteheavec la smaigatt sde les aaptreies cépertaé. sbr> Mirhe , larg2luslle ,sans clusieurs vvrle américains .,dcnore la cppitique daigatiiir Ddminicaine. sbr> JliapFrêébcapé par la sdvilencc p dort-au-Prince, sbr> Lncement do#8217;unejhetre desTonteivateon de sdbens aclteue É(Crrueponidnce rJéthro-Clauee 2Perre Eean ty)si>

WEnàsnitdarté dvec la smersonne .d&pertaé .,dcp ce nier sdjurs ,eor la Bépublique DDminicaine.,ln frrue au qfidèes et ldepomiresx cltoyens vn pctoyense .ert derticuipé,d& s30lusl d015,,dà Ouanamntehe càdne bmrchéeinganisae eor la#8217;Écgaot Stteholque,doumine.plcales. Vêts dd lsnuian , largdrapea cationalessnmarin la crythm dee Dcngieues céxntgéicqes dorônnt l& Craix s l’irmur ,de#8217;écvêue d& dFrt-aLibeteé ostrong class="spip">SQustel NAlphois /strong>, aes eriêrae de va#8217;Écgaot SNorer-Dnm de la#8217;ÉAs=nmpionsau lOuanamnteheat de Ra Por ocss

We trrue a Por oursu a Beute,vationale a6 an cprsantsde vtt le pontelatiodminicainepà Ouanamntehe coùle#8217;écvêue d pludu mas slgeinr s pgneol,daxnt l’irbnui,rdàla Brrnt ire de lOuanamntehe.Mes mvinllerds dt des Fenftt sdrt dté cemiaruaes.l«nbsp;?Pr la sd&pertation sdm sisv sd’Haïti e auelsn earreiiiie ,da rouvernement edminicainepneuoit dua comupr la cbancehscur la uella rl cns u sissnbsp;;»,diélamrela#8217;uhmpm qe#8217;Étgaot ,dui poncideèe lu&erl#8217;aupprt du saeigatt sdaïtiens aontrôibueamuyébeloppement.de Ra Prpublique Dvixsie. CVuraitsdt#8217;ausuurl aquele saDminicainesdonprinne.t erJir slge,de#8217;écvêue dauoit deridurescue tridtssinr s pgneol.Il e psuvlignéconpben àae doanmp de cDminicainesdont rfrctiofiésVorâcedàla Brrcemme laanviside soepsourt sstt sdaïtiens ALs poganisations dd tdéiensmde soeeoi sdhumnrn ,donn l& sScvice Mjéurte àu xceigatt s/strong class="spip">SSoitdartéeuowntraly /strong> r(Sjm/Sfw) ostrong class="spip">SRezouowntraly Jno- Siksè/strong> r(Rfjs) ert dlsts dté cemrésentee.

Les aatorroé plcalessdrt drejintèla panchéers D«nbsp;?Frre cesdt#8339;rs ,eui sert dlll pn Hqutesee#8217;éu dve hmelle rsees mépublique DDminicaine.,lmaléersnuseent quiia’ent sas peula sd&ocuent sdlégar, lDminicainesda#8217;uirqgne.daïtienne.hénotionalect ,souvsneomee gvec lvuvs CVurspe#8217;atr .eor gvbttdonnésnbsp;;»,dapiélamréde#8217;écvêue dQustel NAlphois sor él loit dreiarctles me x pvrle arrnt alire s,caudessuu me Ra Privire dMrsance ,dOuanamntehea(côé caïtienn es dDajabóna(côé cdminicaine).NAlphois sppelle lae doaréiens aoteholque,sdoumine de crovisncp ce dDajabónat dMntex Crse i càds lsoitdartse lvec ll saeigatt sdaïtiens ,vompm qe eorp Rrancços la#8217;af e andeéàu xccvêue pdminicaines.IL#8217;acvêue daïtien àe anden an cême lemps, ldeBeprlusse le fdvlaieeug6luslle l015 sui se e t itcordé par le s atorroé pdminicaine. p dceles cs dce dui pvuvdaitrn parrt tvlongicireent ,lvec lla arantielque#8217;il c’eym ur eas pdeBeaptrei mrn pà erJiomrn -là.dQustel NAlphois s Mdcroié,dsymbolque,ent ,lne bprrescaeSArcadí- Sosa/strong>, Le tiiltait de soeeoi sdhumnrn a,pour ls Por t,exehrtaéda rouvernement edminicainepàpe pas penvoyr sn Haïti pes aaptreies ,dquele cCur uanttatutionne le ldminicaine.p vcré par lsnncrrrte 168-13es moat pe p23(septmbre 20153 /p> Mirhe , larg2luslle ,sans clusieurs vvrle américains .,dcnore la cppitique daigatiiir Ddminicaine./h3>

We tisspora taïtienne.pépllusieurs vvrle aes cÉtts Unis ,donn lPhliaee phi.,lmarhe ra,psimlaaitéent nesc2luslle l015 ,lans le Crr sect verpépllovente rdontre la D«nbsp;?npteoylgeinthnque d& dmtss nbsp;;»dt ra m&pertation eor la Bépublique DDminicaine.d’Haïti e at JliapFrêébcapé par la sdvilencc p dort-au-Prince,/h3>

We tommission eépiscopnisustrong class="spip">RJdticc.pe lpaix/strong> r(Jliap)de va#8217;Écgaot Stteholque,doumine.psmdeitFrêébcapé par la sdvilencc psvisisnt l&ns le Cznas méropoliitirnsad lort-au-Prince, Mnorammnt dens les pqurticnr dopulatress.ICmdtrôe dénéral ment.dar les canig soivenc làla psuld cu llpitiqc e at SRovsl n dApollc /strong>

LS on lsnncrnalys.,ln Pecteur tmafeux elisentasl& sdvilencc pens les pqurticnr dopulatressds mostréibult de soames dlle glessdàles canig . Ue crecrues cete MueSa pvilencc cns ubservaé àrl#8217;auppiche de Dlections ld 2015 .Mesuis qc cweek-nda,gne puiveaention drènerpà2Cté dSleni. ST dQucnro/strong>,"oaété ttué,d& s14lusl d015,,dirs qd#8217;écoanges d& etre gvec lne bprrouvrle d& la rMision de pNtions duniesdror la ptabilitation dn Haïti p(MINUSTAH) Le toaffduelanigdrece rhé p ur t lreise de secdousit trsààln frrurle d’éu dprrouvrle ,hvait aait isnvir Ja pPpite eationale d’Haïti Encemréseirle , largommissiaritigu llpite MueSCté dSleni.oaété titeauaésor les cntdividrspen dnentiefiés CUnàvéhcuulelanr desvtt le ponmissiaritige 1nesaansparmatiur tlectiique Lut eté tndaometgé. /p>

WL eontreôe le sdqurticnr dopulatressdst peoujurs duifeciee pour le plpite eueiao#8217;avpar des Dmtye auels Bppitique cénplne pApollc ,pcndatmntt le#8217;Éabsetc de la#8217;État hàlCté dSleni.,doùdes Fbadiai d èmetsdeaaenrreur e diteaua.t d lltisibes pitoyens vror la soepersllenrde clurs vlens AL pcrusnd&elc smvilencc pésideneins l’épbsetc de lvalorsstion ,cartla#8217;État haïtienn,de soations lrrstiqvs ettre réie spar les cjeun aes cqurticnr dopulatress lnssia lstrong class="spip">JLoisno Rrililrd /strong>&,pcn-fndatteur e dvlongicirede#8217;Éunmmuvermetsd=niétlcénonmm dstrong class="spip">SKonbt iSleèyLe v&. «nbsp;?es cjeun ,eui sn sont sas pilltait sdouitiques ,a’ent sas pla arâceddn putorroé Ce qont saautô es douitiqc e at Lncement do#8217;unejhetre desTonteivateon de sdbens aclteue

We tiiistrèe daïtien àe le cClteue< s l’iUnoerseté dprivéepstrong class="spip">SQuisue ya/strong>, (Unoq)ert driocéd n l’aiaaugurtion ,cesc29lusl d015,,do#8217;unejhetre desTonteivateon de sdbens aclteueJGoupe dImagns .cete /strong>, (nstatutionnl& lrece rhéeat de Rébeloppement.)pe lesdstrong class="spip">SSmithsntian Istatuti&ad satats-Unis je#8217;Arérique .LesRouvernement eaïtien àupprt ne eu mantait de 2villions ld 2ourdes eur lne pnnée four laidl aàdretde la jhetre dopralionsnel Cepte aouvelle pnstatutionnl«nbsp;?lisse daugure une avnuirglovmpte urduandsaàla Bpésiivateon de sdat vf aclteueSDithny Joan Ratc /strong>

LAdesse, &uC,en nbsp;: http://1ykp.mj.am/link/1ykp/jk0r5xg/6/YgwvF5cLfLYP_MxDaIY-Vw/aHR0cDovL3d3dy5jb2xsZWN0aWYtaGFpdGkuZnIvY2FsZXBpbi9maWxlcy91c2hfMTE5NS5wZGY

/>

ort-au-Prince, M19daril 2015 s/br>
epte amnarmation ,eui srovisnt douÉNuvellese e/i> Éaïti .Cnsnexon -Clteue
, témoinerpunmpeulpus as#8217;Éille sfalauit edu olimaidesTonrrupionsaxterme lui seévi ldepom cjurs déns lesprys, s/br>
/p> 4ph3>Lbérétion adepSouonsàe trailltadouplelusgment.de Ra Phntienbsp;? /h3> p class="spip">Ps/br>
/p>

Weecaibunal dcrmetnel siégrntsdtns l sisstnte MueSjurym elbérééda rv nde dif17 Aril 2015 dstrong class="spip">SWoodly Ethéate/strong>, aaltasdstrong class="spip">SSouonsàe traillta/strong>, at RRnel NNelrrct/strong>, aes ee x paontuipu xcoaff duulanigdstrong class="spip">JGaltl/strong>&aaur uitrisdror leneèv ent ,lséuestiétion aontre lancço ,eiétecidllecietsce lstupéfvste , blncehient mes cnvir s,casiasisntige 1as=niétion deslmalait urs .NCelusgment.daeté teponçcél& uis qjeudigpr la Rstrong class="spip">RRésea cationalesd tdéiensmde soeeoi sdhumnrn /strong> r(RNDDH) ct vrasonsàdu odactuèe lspéiétlcée l sisss pirmetnela pésalsae apr la Rusgmlstrong class="spip">JLamdarraBéitzair /strong>, arpubé dprche de la#8217;Écui pela coivoir . SSoueesean -rancços /strong>&. Dns les pillt x paoohéetcu Poivoir onsprésentdlu&erl#8217;auruepation et ra m&pention ,l’innée fe nieèes,d&elc sme x preponisble ssuupanigdGaltlDlaitrn pté ttès aml Gacuseiles dor la#8217;Écui pela coivoir ,donprtedienule ge rs ,en dvec la smeluspaoohéetccoleabortiers deuqrisident Md la République . sbr> stpnd oass="'pip"_&ocuent _1913 pip"_&ocuent s pip"_&ocuent s_oetrer' > s mg src='IMG/jpg/Souuons_Laraillta_et_Rnel .jpg' width='300' height='209' ale="" style='height:209px;width:300px;'class="'' />/stpnd>/p> Ws/br> Lesamnarmation sfommunaquaé dor la plpite ee les aavex de cl plauart ee commpite sd&elc sme x poaff duelanigdfon poroie lu&ere te das=niétion deslmalait urs anlroccéd nn cêins de me x pns l da#8217;axneèv ent uitrice lséuestiétion aontre lancço ce l17 ersonne .

Lens lonsàidémnnace du.drntio ,rl pusgmlu#8217;annstrction nSoueesean Rrancços lamaenton nrd’éensmbre le sdnfdce brouvvé pens lescadre deeue te dxtqutes Fascin cor la#8217;Éée glce du Cusgmlu#8217;annstrction nans la crpdction de la#8217;uidémnnace du.drntio ,rl ponmissiare,ee pouvernement ,ldns lonsàréu&isteiir Ddéfvnt ifmoatépe p23(férile u015,,doélamrelonciidétt sde lsuffistt sdl sdnfdce bn pchlrge pretnus dontre lc sd5 dntuulé spaur lue#8217;il céspodant mes cait dui se rs sit dreaoohé CD p23(férile u015,la c17 aril 2e cl pême lnnée soie 1nesmti d l03djurs ,ecelême lpnrue t,cartla#8217;Éetre iss puelsn eemrésenteat ,lMsustrong class="spip">RJan RAbnn lEill /strong>, areoncinlàrl#8217;aucusetion ertaé dontre lc sde x poaff duelanigde remqucnr le pryenseeuqtibunal dcrmetnel,lMsuLamdarraBéitzair ,sd tdélamre les Dait dnn aonttatte de remnvoyr ses aacuse dhrs qds ml e auell#8217;aucusetion .sbr> sbr> stpnd oass="'pip"_&ocuent _1912 pip"_&ocuent s pip"_&ocuent s_left' style='float:left; width:300px;'c> s mg src='IMG/jpg/Jsgm_Lamdarr_Beitzair .jpg' width='300' height='204' ale="" style='height:204px;width:300px;'class="'' />/stpnd>/p>
VoilàlesDaiço cgrssieèr ponmint nescemrésenteat rdupoa ue t,cui ses uce éptre cescemrésenteat rdela psuciéé ,ts#8217;est pommprtaédc rv nde difens lescadre deeue dossiers.NCelui ses uéc#8339;rsat ,lc#8217;est pu&erl pjsgmuLamdarraBéitzair laeacordé pa Por olsààln témoin,cui ses ul#8217;éne b&s mvicsia sdueSette das=niétion deslmalait urs .Nstrong class="spip">SRomnrn Arande/strong> rrévèl cveir Jvnrse 180 00 adolear américainssds mcoangesauels Blbérétion ,dprès lveir Jté tndlevéen lséuestié cor lcelanigduirig cor lcesde x phmpm s.dQuslrsmnel dl#8217;audmiistreaion nstrong class="spip">SMctelly /strong> rvext- le ldmnnn làla psuciéé p deriersevcelusgment.de Ra Phntienbsp;?<

LCnmint nessphmpm soe les afepm soui son pté tvicsia sdu#8217;auct sdueSkidncppig cochéetréescor lcelanigdvont-l cacuseiles la#8217;Ééelrgsse ent.de Rcesde x phmpm snbsp;?

We#8217;amtquteseesalsae eur l144pays ior le#8217;énaépendantc d&ela pusticc.,doùdaïti pst poass=é l134e,qn#8217;est - le lar desprefle rdupanciion ement d la Rusticc.pous le Bpésidence dueMMichl NMctelly nbsp;?

We pjsgmuLamdarraBéitzair laeidémnnérv nde di,n l’aisse d’Hunmpichès-élamr ,dl Blbérétion b&s monmm s Woodly Ethéate (Souonsàe tFaillta)mt dRnel NNelrrct s/br>
/p> 4-0-0-0-0-0-/h3> p class="spip">Ps/br>
/>

ort-au-Prince, 31tdélmbre 20154/p> 4BILAN DE L#8217;ArNNEE20154/p3> p class="spip">Par lstrong class="spip">SMichl NSoukar/strong>&/p>

WEnàoncilutt le pbila dd t’innée f0153,souvsnavins lresvulu&erl#8217;aunée f0154se e t icele d& loutsle s eponre goud& loutsle s oangnrs.d Encdéfvnt ive,allesoaété thele d& s eponre gdéçu, Le tdialogue amcoaoué Ls pontelaations pnn deriin cn àang>uurs C Ls pnégniétion suvéictble ss’ent sjaais pdbmlrré. sbr> sbr>/p>

Wstrong class="spip">4I. SUR LE PLAN POLITIQUE/strong>& s/br>
L#8217;uunée f0154sadeéut édous lesrsmnerpeutdialogue.NAl’Ébcasion ddela pommuémortion deudjursde la#8217;anaépendantc d’Haïti o& s1n ljanvle u0154,Le trisident Md la République ostrong class="spip">SMichl NJoseph Mctelly /strong> ,dapentiélu#8217;annvrem lu xcGonaïvs ees aanc e arisident sMd la République avixnt lor él larreiiiie C Parmidce dui prt dlcoep éla#8217;anavretion ,ce Bpésiitc de la#8217;Éex-isc aeur ,dstrong class="spip">RJan -ClaueeCD vaioes/strong> ,dapté tviv ent crmtiuae par las Daimrle aes cvicsia sdueSa pirc aers
L Bevnréespar lrent trescu#8217;est pffectué erl pe x ime siudit ueSjanvle u0154 C Ls piéateur sdrt dreontuit nl pBreau duirig cor la Riéateur dstrong class="spip">SDinuseulMes anscSimn /strong> ràle ptêt pe pSéate C Pardontre ,aàla pchabre ea s Dpubé Has rdpubé du cgoupe dar lrent trescour le pSabilitaéen lasgPotraèsd(PSP),paoohéetcu Poivoir excuréif,ert draflénl pBreau dinssidu&erl Bpésidence dueMout s ees aommission .

LA. s class="spip">ÉSLE CONTEXTE/strong>& /i> s/br> esuis ql#8217;aucuesion e&uCpésident MMichl NJoseph Mctelly la coivoir d& s14laisu0151 lvucn acectionsao#8217;avpté tnganisae eéns lesprys, LIl ennast pésumlt des Fvacacc pa civeru deetccolect veoé parreiiirilessd(sctions lommunaaes cs dcnmunaes)mt de pSéateMd la République oampuiélu#8217;an tinrs.dLePoivoir excuréifennanlrocfitépour ue iplac le pqusio-totlecé cdetccctell deeviagstreaisÉleu Car les cagnt sMexcuréif vnteéicmtress./p>

LB. strong class="spip">4ÉeE NŒUD GORDIEN/s> &
L Biss pn palaceee pEnseil SÉectoral.bPerandnt M(CEP)de m rseelt2n#8339;rd grdoin àe crocessus électoralx de uis ql#8217;audopionsau le cCustatutionnl& l1987 LIDrsat ees atriss (3)pns l&uCpésident MMctelly la coivoir ,lesprys,sadeéjàdcnonudqusre c(4)Jvnrsons ld 2Enseil SÉectoral.bsns la centu dd#8217;Ééections lrur lauiant./p>

We tremière fvnrsons,lespEnseil STanspteiir Dd pEnseil SÉectoral.bPerandnt M(CTCEP),duirig cor lMsustrong class="spip">RJosué2Perre -Lois /strong>&at REmanduslrMéatd /strong>& C Pis qvitsdeaaerissime svnrsons,lespEnseil SÉectoral.bPovisiire ,duirig cor lMsustrong class="spip">RFrizto Cat n /strong> ,SMcxMMcthuinc/strong> ,danien crisident MdupEP Vd 20106,panciion eaàa coupleet./p>

WEncoure ,Mo taines fivperstiqn sdueSa ploidlectoral ,Mvoté pn p0153,so qont saau,sadapee. àa counexte éatuéel CnSouoamnd nent u#8217;auvre fnfdcsendsble .

WC. strong class="spip">4ÉeE DIALOGUE INTER-HAITIEN/s> &
L BCunirence cÉpiscopnisué#8217;Haïti (PEEH),duirig eor la#8217;Écvêue d& rCdys ,SMnseilnerr dstrong class="spip">SChiby lLanglos /strong>&,dcnoviir le poivoir sdu#8217;atat ht ra mlass=egouitiquesdaïtienne.pautdialogue lvec lsa2iédiaiqn .PPa lllèleent ,ln évéement sns lrociédnt dens le#8217;ahstriir Dd pays io#8217;est procuit nl p12Sjanvle u0154 C Ls Vaiqcacmonmm qe eoomier Mcadointldaïtien àtnle Crr sone.péplMnseilnerr dChiby lLanglos .NAlor, largoadointldChiby lLanglos (lacinlffecienllnent dlepdialogue nd neeaïtien àetre la Doivoir excuréif,ea Doivoir iégisltiif aes era oi gouitiques ct ra msuciéé pcveole,n l’ahôell El Rnceho /p>

WPus td#8217;éne bqurtitstrnsad lra oi gouitiques cyert drspodauDaivoible mrn .dLePMuvermetsdPtreioique d& da#8217;éOporstiqn Démocraique d(MOPOD)pn boudéla#8217;anavretion C Ls MOPODanlros cdetccmdiaiqn apesalble ssàas Por toeipnion C Souoslogananleoujurs déé péections loud&éission e&uCrisident Md la République .C Parmides era oi gouitiques crésente Has rPa oi dFusons,lKntrea Pèpla Rt rFanmiLa vledso’ent sas ptnrdécàds lretien ld la Rtble peutdialogue.N

We pdialogue ouitiquesdnd neeaïtien ào#8217;est prur uitri endantede x p(2)smti C L#8217;aucurdédui senast pésumlt dnsssoignécor la Rrisident Md la République ols cemrésenteat sau Rrièsau R48era oi gouitiques ct ras cemrésenteat sau Ra msuciéé pcveole C Ls risident MdupSéateMaccmdiaiqn nécsarsmneleue

WCeendante,cresqséad lra oirn l’aéaansge ,lesprisident MDinuseulMes anscSimn tadonnnécandea laupiéateur dstrong class="spip">SSteenc Benoit/strong>, asctrétair Dd pBreau ,sd tsmnerrcetdsncmonm,lmalgréce Bpésiitc deucvice-risident MdupBreau duupSéate,la Riéateur dstrong class="spip">SAdari gRiché/strong>& C L Riéateur dBenoitsa#8217;af oignécn criononçnt du mostours de smeluspélogo x .C Purseat ,ll c’evpar dris leuqtmps,dror lénoncin la#8217;anacluson desla#8217;Érrtoeesc12Séns lesdt itcordé,pnxliquaat du’Éills#8217;Éctit lait ipiégrr /p>

We prisident Mdupbreau duele cChabre ea s Dpubé Hasrdpubé ostrong class="spip">SJacues cThimnlén /strong> rf oignécl#8217;aucurdéds mcmptent dettaines fésiiva. Six (6)diéateur s,cartmides u&elsnbsp;: SMoïsedean -ahatl,s, John Joë NJoseph,2Perre Eranceky Exis aJan RWilesamEean ty, WstelrpPpiyoadpe/strong>&at RJan -Bapese e Ben -Aimé/strong>&ert drisqséals risident MdupSéateMdepe pas psmnerrcl#8217;aucurdédui s crixéra m&at d& da#8217;éiranisation de Dlections lommunaaes ,liégisltiivs et liéateirilessdu d26octobre 20154 C Technque ent ,lespEnseil SÉectoral.bPovisiire (PEEP)dn beiirsau lsix (6)daoisdror liranisar ses alections ,n lra oirne cl plblicstion desla#8217;Érmnd nent àSa ploidlectoral Vd 20113 C L#8217;aExcuréifeauoit dlblicrrcl#8217;aurrteélcnovouatt le preuleeàn Hse lommce bcesc26octobre 20154 CcCur t-circui tt le pEEP,l’iExcuréifeauousis le srioje l’irmnd nent ueSa ploidlectoral àSa pChabre ea s Dpubé dui se#8217;evpvoté s l’irttanspissdu dSéate /p>

Le. strong class="spip">4ÉUN GOUVERNEMENT PLÉTHORIQUE/s> &
L#8217;ÉAcordédd#8217;ÉEl Rncehomt,letre lutres, connnéceeurdàln ouvernement ed#8217;éiverntrs a& 43dambres ,Sicilutt l10aouvelu xceiistre et l10aouvelu xcsctrétair sdu#8217;atat C Ue ouvernement epléthoique .LParmides eouvelu xceiistre ,pitoynslMnseiur dstrong class="spip">SDuy lBrutu /strong>&au dMiistrèe daes Affair sdEaansgre cesd& rCmlts ,SMnseiur dstrong class="spip">SNesmy Mnisgat/strong>&au dMiistrèe daela#8217;Étuctteon pNtionsl t de Ra PFrmation PPovfesion nl l ,lMnseiur dstrong class="spip">SHimmenrdRebu/strong>&au dMiistrèe daelaaEeanaess<,pd rSpro sde l& la#8217;ÉAcion PCveoue oMadaa lstrong class="spip">JMnsquesdRoourst/strong>&au dMiistrèe daela cClteue<,lMnseiur dstrong class="spip">SRudy Hérveru x/strong>&au dMiistrèe daela cCmmunaqction ,cMnseiur dstrong class="spip">SLrn rdRneaud/strong>&au dMiistrèe daela cDéiensm,cMnseiur dstrong class="spip">Srancços lGslleaumsaII/strong>&au dMiistrèe daes aïti e aVixnt l l’aÉaansge at dMnteiur dstrong class="spip">SRegintldàDelva/strong>&au dMiistrèe daela#8217;ÉItérêeurscesd& rColect veoé pTrreiiiriless LIl ecnovi.t d lsuvligne a glesint nescemtursde lMadaa lstrong class="spip">JMaicsaCamesle dJan -Maics/strong>&au dMiistrèe daela#8217;Étonomiq.et des FFinace s./p>

LE. strong class="spip">4ÉDES VOYAGES INCESSANTS/s> &
Enu0154,Lls risident MMctelly lapffectué ldepommresx cvoylgesn l’aéaansge dui se#8217;eon pontuit nn Hrérique MdupNrdo ln Hrérique MdupSud,d&ns les pCamaïb cesdn HEurope.d Encdébu l’irnée sls risident MMctelly lapffectué lonsàlomier Mvoylge ffecienlsu xctats-Unis je#8217;Arérique MdupNrdodoùdills#8217;Ést pftre enuuavec la prisident Mstrong class="spip">4Bdactk H. Obama/strong>, aa Rictrétair Dd#8217;atat hJstrong class="spip">4ohn Krrey/strong>&at

WPuis,la Rrisident Md la République anlror uitri onsàlricp àSPrssa ln HBelgoue on HItleceae au Vaiqcacmoùdill Por toeipéaàla pcérémoie du#8217;annstalauion deudCadointldChiby lLanglos C Ls risident MdupSéateMDinuseulMes anscSimn t laplsts dris lor t,einssidu’éne bimprtante eeée glion daïtienne. /p>

LA cours deufd x ime se entre de la#8217;uunée f0154 sls risident MMctelly ls#8217;Ést pretdrdàlNew-Yorkn l’aONU,n lCubt,let Éuitrur ,dn Hrllneage.pe lenRrance .NJMerkel/strong>& /p>

We prisident MMctelly lapéé péglesint nesclomier Mrisident Mn àtxerciinlàrs lreuseiles lens lescadeho Md lstrong class="spip">STlussaitsdLiverntrs /strong>&au dFrt du NJox .CPuis,li.oaété treçuau dPalis pd la#8217;uElyse four lun trénaqn d& loanvisidvec la prisident Mfancçis pstrong class="spip">Srancços lHolead n/strong>& C C fe nier Mvoylge n HEuropep ur t lté tsns lhstriir Dsisls risident MMctelly lnels#8217;Éctit lor gvenc uréaàlucurdée lun tftre ue dàctriss (3)pjursalecttesmfancçis pchearonnésduele cChaîn ts class="spip">ÉTV5/i> , ouÉMod n/si&at ÉRadioPrance rIternationale /si r(RFI) AL pperrrmattc deucrisident Mlisseit làeeésien LIDestftre ue sdueSet genescuecrisor ent./p>

WF. strong class="spip">4ÉDES FAITS SAILLANTS/s> &
Depommresx cévéement grt ddéfanyédaafohrnsquesda cours de sa#8217;uunée f0154 C Ctoynslnorammnt nbsp;: /p>

W#82126; a pirspartéon desla#8217;Éhmpm qe#8217;Éaffair sdstrong class="spip">REvinx Dnsiel/strong>&dui ,ls bree-r-l ,spbrouvleéals eomeel 2e cettainetcccceues céxolutt lens le#8217;ant ursagel&uCpésident MMctelly nbsp;:; sbr> #82126; a praèveàe crocfesiers de smécoes erblique s, uitri daela cmn&festationsau aleèvesdror letigr lespryieent mes csaltre sdue Drocfesiers nbsp;:; sbr> #82126; a pséuestiétion a&uCecoeur tesla#8217;ÉUnoerseté de#8217;État hé#8217;Haïti ,l’ingionoa lstrong class="spip">JJan RVrnemt Hene /strong> ,dt de preponisble tesla#8217;ÉUnoerseté deeRJan -MaicsaThéodat/strong>&aar les cétudiat sau Ra dtenlunoerseté nbsp;:; sbr> #82126; a pCur ue#8217;Arppeesd lort-au-Prince,oaétissduncrrrte,fens lescadre deeu’insiasisntigd lstrong class="spip">SJan -Dminicue /strong> reigd lstrong class="spip">SJan -ClaueeCLois saits/strong>, areovoylt m9 embres du pstrong class="spip">SPa oi FanmiLa vleds/strong>&ad vtt leaéjuriirc on deslusgment.nbsp;:; sbr> #82126; aestftnis qjuiacoires de sa#8217;uunien crisident Mstrong class="spip">RJan -BttarandaArse i n/strong>&eueiao#8217;avpar drspodauDàldepommresx candea sétissdpr la Rusgmlu#8217;annstrction nstrong class="spip">SLamdarraBéitzair /strong>,dui se#8217;evpfintlment eplacécn césidence dureveileéenbsp;:; sbr> #82126; a pmrt du Na#8217;ÉrmbnsiadersRGuylrlexande /strong>,dui saéj aéeens le#8217;aémoila#8217;anaellyigrt siadaïtienne.nbsp;;; sbr> #82126; a#8217;anrrupionsau Na#8217;Éépi&pis deeufière lchi kn on yadui saéafectu cdetccenaines fievillioes qd#8217;Hhbilait sdor éél larreiiiie cationalenbsp;:; sbr> #82126; a pmrt du Na#8217;Érnien crisident Mstrong class="spip">RLeseceaMnisgat/strong>&aui saébénéecie dee #82126; a#8217;auruepation ed lstrong class="spip">SWoodley Etheate/strong>, adt istrong class="spip">SSouonsàl traillta/strong>, aous le Bpésventon ueSkidncppig ,do#8217;uas=niétion deslmalait urs aeigd lblncehient me#8217;aurgnt.nbsp;:; sbr> #82126; a#8217;aurrteduele cCur ue#8217;Arppee areovoylt ma#8217;Érnien crisident MJan -ClaueeCD vaioes esvtt le ptibunal daur lcria lontre la#8217;Hhumnoté nbsp;;; sbr> #82126; a#8217;aévsion dsect aclatresad lrus td dtriss cnt M(300)m&pentusduele carsonsàcveoleduele cCrisxdess-Bouue tsdonn lstrong class="spip">SCliffrdodBrandt/strong>&anrclpvae predantede x pjurs nbsp;:; sbr> #82126; a praèveàe uoitmdeufdpubé ostrong class="spip">SArel NBéitzair /strong>, aans la csale d& lséttc deucPa leent ,ls#8217;Ést perretné pn pue e d& dpocssonnbsp;:; sbr> #82126; a pdcieson dmalaeeoi daela cDGI mptent dt vuetregne puign te dxtcême lemps,pu&erl plncement do#8217;une aouvelle ppa uellu#8217;anmmtreiclation nbsp;:; sbr> #82126; a pmrt du Na#8217;Érnien crisident -à-ri dJan -ClaueeCD vaioes t ra mlntreoinrs Ror él laypldéelfuéralrle a(ationale s, ffecienllns,dprivées)n l&i sacurdée . sbr> #82126; a#8217;auruepation ed lstrong class="spip">SRony Timnthé /strong> reigd lstrong class="spip">SBiong Odigé/strong>, aa cours de sa cmn&festationsau d26octobre 20154 aalang>eSa plittldéescarsonsncnr dopitiques ,andilutt le smfaèr sdstrong class="spip">RFlne stal/strong> reigd#8217;autoes danifestatte nbsp;;; sbr> #82126; a#8217;auruepation ed la#8217;Éhmpm qe#8217;Éaffair sdstrong class="spip">RNazair /strong>, aunmpiche de la#8217;Éex-risident MJan -BttarandaArse i n,dt de ponmissiare,ee llpite Mstrong class="spip">STéeémauellClauee/strong>, aafectu ca ponmissiaritigu llpite MueSLéogan ee lesr leteridtiqn u xcÉtts Unis ,dor la Ricvice Mu llpite Mfédral américains (Drug Enrrcement dAgetcy)nbsp;:; sbr> #82126; a ppésiitc deucbeu-Pfaèr l&uCpésident MMctelly ,cMnseiur dstrong class="spip">Sahatl,sl«nbsp;?Kikonbsp;;»dSaits-Rémy/strong>, aans la cmn&festationsanganisae eesc18Rouvmbre 20154s dort-au-Prince,eor la#8217;Éoporstiqn ridtalesdontre la Doivoir etaénoncçtt le smanuvis pagsse ent.se&uCPomier Mmiistre La u ent S AL mnth. /p>

LG. strong class="spip">4ÉeE 3e ANNIVERSAIRE Á LA PRÉSIDENCE/s> &
Leaerissime sannoerseair Dd ppésident MMctelly la coivoir en lasgd x ime sannoerseair Dàla Bpéimaiur Dd pPomier Mmiistre La mnth.son pté tommuémoré pens lne pnmbintc d&elcarnpvae LID#8217;autcun io#8217;eitentditrn pàln bila dd pésalsations dd PPivoir Excuréifennaerre sdue D5l«nbsp;?Enbsp;;»,droôn spar le Cpésident MMctelly nbsp;:: sbr> #82126; tuctteon nbsp;: #82126; Emploinbsp;: #82126; Énergienbsp;: #82126; Enviongnment.nbsp;::ra mlnverntrs avégétal Dd pays ist pésdrte àompm qpau duelchaginc LI csuffi de Ré x pjurs Tontecuréif vd lrusiepaur lue b&s mvile asotrn pioncdé s,caec la r élo de Rébgâtsmanérêeul aeigd lprntestftdve sdhumnrns ctat eom cmorn asnt sénoudé snbsp;:; sbr> #82126; Éttigu lDeoi nbsp;: RLioueesBourgoisn/strong>, aorte ààln ontflitdvec la pictrétair Dénéral ueSa pPésidence daupiujt de Ra Plblicstion dessdrènl mrn sdnfernas du pESPJl&ns lesps class="spip">ÉModt urs/i> , essduruepation dlle glessde aurbieriir sdu#8217;aoporsit sdouitiques s l’innstrcent tlsation de la Rusticc. /p>

WCesl«nbsp;?Enbsp;;»2ont resvntusduelrus tn palu cbarslle dueuis qu&erl pPomier Mmiistre La u ent S AL mnth.saéajuru cdetcpla aspéiétx paor loanua communae,Mvoir Dlcaleté ,tans la uella ro#8217;eiranisart le smfameuss fésnaqn scénonmm esl«nbsp;?GivencmamAL kaynbsp;;» LIl enû eissx cvalufour lunprys,saspirnt l lesvntr Jtmergnt.tans l5,las de mevpersnrde#8217;eunpPla dqisnua.tal dui pf e t ia#8217;uibje l’iévalution ericodque ./p>

WH. strong class="spip">4Ée#8217;ÉINTENSIFICATION DES MANIFESTATIONS DE RUE/s> &
AJir ue lu&erls cjurs Tpase ts, essdoangce td da pésalsations e Dlections lresvuescesc26octobre 20154io#8217;eienturset .PPa lllèleent ,le sman&festationssdue res ,anganisae aor las Dra oi gd#8217;Éoporstiqn rslamett le pdéart ee Poivoir &uCpésident MMctelly ,csscsit dnferseifié

Lespommresxsescvrle aescrovisncp,dompm qe eCap-Hïtienn,dL rCdys et cPetit-Goâvedrt drelnyéda smaotsda#8217;uirre deeuan&festationssdtissdpr la Dra oi gd#8217;Éoporstiqn .NAlPrt-au-Prince, Mc sman&festationssdrt doivenc lonnnéceeurdàle céchauffurséestftre le sman&festatte de ressdugnt sMd la RPpite eNtionsl e#8217;Éaïti (PPNa) ui prt dfai edsTrus tn palu cl#8217;énsag de lgazla crymogèn cesd& lcanos l deaufour ldisseaeerle sman&festatte .d Encd#8217;autoes dbcasion Has rugnt sMd la Rlpite Mpichèdet l l’auruepation ed spoaff duelfole C C lu&erls cra oi gdela#8217;Éoporstiqn asisill t l lessduruepation dlle glessde aurbieriir s.NAnts ,drslameent-l cl Blbérétion b&s marsonsncnr dopitiques /p>

WPa lllèleent ,le pvot deeu’inmnd nent ueSa ploidlectoral ui saur t lhbilitaéeespEnseil SÉectoral.bPovisiire (àliranisar ses dten alections ,nst pans ca#8217;Éimpase C Ls p6piéateur sddela#8217;Éoporstiqn nn denuuatêt pa coivoir en boycotent dout spentia verpéplrénaqn da pSéateMd la République tustu’eàle pfi de la Re nieèesHse ion ddela p49eliégisltiue<,l& pe x ime siudit ueSseptmbre 20154.N

WL pésoetrefvistenldecemrésenteat sau PDéart ment do#8217;uÉttigméricains o#8217;avpar drsnts dàdftrescoicrrcls p6piéateur sde ressdra oi gouitiques cdela#8217;Éoporstiqn ui se sdorpprt nt .PAnts ,da pé réie pd ran&festationssdue res, rslamett le pdéart ee la#8217;Éexcuréif,est - le lsusoep ile teslaansparma le pcriseplectoral engne pur t dcrisepouitiques.PPa c lu&ersi e Dlections ln sont sas pnganisae aour u&eeemouvelle mnt Mdela pchabre ea s dpubé de Mdupandea les c2/3duupSéate,la RPa leent me e dysanciion emlnl p12Sjanvle u0155 /p>

LAlor, lnceapble te#8217;avpriquarrcl#8217;aurtoeesc12Sé la#8217;ÉAcordédd#8217;ÉEl Rncehomt dfacedàla Btursnue lréie por la pcrisepouitiques sls risident MMctelly lapreonurrdàle contelaations pvec la smemrésenteat sau Rommresx cs teurs gdela pri dationale C L#8217;aoporstiqn ouitiquesdjugée irésdrc ile trslamee àdcn en làpcri le cnégniétion suvec la prisident Mour urouvve lun tisse dàla psitution Pu#8217;aimpase pouitiques. sbr> sbr>/p>

WI. strong class="spip">4ÉCONSULTATIONS ET PROPOSITIONS DE SORTIE DE CRISE/s> &
esuis qledaoisdueSseptmbre 20154 sls risident MMctelly laplnceélun tsricsaae

WCeslontelaations pli son ptglesint nrrreisdueSreuseiles lu àtnsmbre le lreoerstiqn sdueSsoticnd&elcrise AL ppauart ee creoerstiqn sdsuggre t nescemiplac ent d pouvernement edirig cor la RPomier Mmiistre La u ent L mnth.,ce Bpélonggtion Pdupandea les cPr lrent tressals-delàleup12Sjanvle u0155 s l’iiranisation de Dlections lommunaaes ,liégisltiivs et liéateirilessdéns lespeel a r édélai C Ls risident M Bpélmi gd#8217;Én àtfectuée lun tsynthèe danssidu’éne brésenteaion dàla pNtion .sp>

Le#8217;eunpcôé ,tommresx csot le smibeivateur sde rrnalys s eruitiques cui sasisill t lc péenontre sààln fand#8339;rre ldiltiire ,dontesstnttdàdftrescoase él larmp .d ens lonsàftre ue dàca pchaîn ts class="spip">ÉTV5/i> , ls risident MMctelly ln#8217;avait -l sas plaiqséaetretde lu’Éillitentde t ia p12Sjanvle u0155Mour upretde la fivperstiqn sdnéuesitressds mv&erd#8217;eiranisar ses alections ennantentenldeuis qsnncrcuesion eàSa pPésidence dn p0151. e#8217;eunputoespcôé ,tas Dra oi gd#8217;Éoporstiqn ridtalesdontrina.t d lrslameerra m&pission e&uCouvernement ,le crrmation Pu#8217;an Enseil SÉectoral.bPovisiire (éu&ilbéré, uitrlt ma#8217;Éesprispe d’ar toeesc289au le cCustatutionn,apesalble ent.daupvot deeu’inmnd nent ueSa ploidlectoral or la RSéateMd la République tinssidu&erl#8217;iiranisation de#8217;Ééections eénéral m déns lesprys,dn p0155 /p>

LLsc28Rouvmbre 20154 aa Riusendsepctit làqsnnconpbe C La ridtosannncçti pu&erl prisident Mallit loésenteerra msynthèe de creoerstiqn s aa cerre ea s dsx caoisdueSontelaations peggtge. àaec la smuiferenct as teurs CcCurpteslahéâoesnbsp;;!

WCete dcnmussion est pommprsésad#8217;en fdtzainsad lrersoneleté s reoencat rnorammnt des ms teurs greligo x ,pouitiques s ld Ra msuciéé pcveole.d Enfin sls risident MMctelly la,pens lne re fJir sag ,doélamréTonpben àaedrys,dctit lutriséen ls#8217;Én àomiptenitààln fcnmussion eour u&i pfare (un treonmandea qn dueSsoticnd&elcrise AL pdrséePdupandea lesRa dtenlcnmussion est pesRhit n(8)djurs ,ereobble ent.d lra oirne cl p&at d& dsnncnnstalauion .desR55Mdélmbre ,la pCmmussion ereonmande la fipission s d pouvernement eL mnth.,c&uCrisident Md pESPJ,pd rembres du pEEP,l& Blbérétion b&s marsonsncnr dopitiques dompm qir ue sdu#8217;aultis mrn .dLeP25,MMctelly lehoistele lresenteerrstrong class="spip">4Yve aPaul/strong>, aa Reeaeerne cl pKIDdompm qfutr upreier Mmiistre ,lesvtt lne SéateMhotatle.d Etre -armp ,n l’avprrche de la pfi de la#8217;Érnée f0154 sn tadibeivaé(un treorud .cete e sdat sdu#8217;aitecurroé LI cnels#8217;Ést prss=élun tsemnrnstsns lue d& dltisibes pitoyens vhïti e an qfuse tsdvicsia sdueSbraqulgesneigd#8217;autentia sdpr lballns,doie 1a coftre -vrle dueSPrt-au-Prince, MààDelma ,n lPéion -Vrle loud&as de#8217;autoes dvrle aescrovisncp. Anssi,l’innscurroé ,rl#8217;iiranisation drépété deeuan&festationssdescrovtepation et rasRblocag dsncpssat pd rvoiesdueSonmunaqction clternréginale .aaltmetret l’innstbilitaéesucioouitiques.PDonc,l& Bnnsanganisation de#8217;Ééections eour u&eeemouvelle mnt Mericodque de cistatutionn pdbmncraique s,l’inneapbccé cdetcrrcem de coiliinlàrgrtitsqrl& Cscurroé b&s mvis s ld rbens acorreponient Meut s eàde la#8217;Énnstbilitaé C Ue.hsitution Pueiao preu ptre crocfitabl lu’ÉàSa pMssion e&s eNtion Unis aour u& pSabilitation dn Haïti p(MINUSTAH)donn lls andea lst pretuvellétustu’en Hctobre 20155.

WII. strong class="spip">4SUR LE PLAN ÉCONOMIQUE/strong>& s/br>
L#8217;unnstbilitaéeouitiquesdn lsoiétlrMaccrélcbeu-curpte#8217;inneeratutdeeens le#8217;aéonomiq.eaïtienne. LIDelpus aaïti pontrina. d lrslolterne canuvis pscorm déns lesprupprt Plblicédéns lespeagazrnstl«nbsp;?FormignRPpiteynbsp;;» LIEnu0154,Lls rys,sadoccupédaaf8epalaceeartmides l10aÉtts uoitlio du pmnien,dn Hommpagni deeu’iAfghnisaant,c&uCYémet,c&uCSoudanMdupSud,d&u Tchld, uele cépublique tDémocraique du pEnsro s ld Ra mSomaioe LIaïti p pperu ptglesint nuellues crlacesaa coass=eent d prupprt Pd R«nbsp;?Doig cBusrns snbsp;;»2or u’éenviongnment.lessduffair s /p>

WI cns uimprssile tens ce tccmdiaiqn ad#8217;auteien la#8217;anav sios=eent dir tecétansge LIl ens Meut alsts duifeicie tens ce tccmdiaiqn ad#8217;auteien lessdtursis s erur lassur él lalx de#8217;iiccuption dnéuesitreseàSa penctbilitaée&s monvelle samnarastrctiue sdhôellièr sdonttarui s eàdPéion -Vrle letd&as de#8217;autoes dréginaspéuprys, /p>

WSa dltv sios=eent dir tecétansge dn lsa dtursisme,li.ost fivfeicie teeprocuite ea s richsse, , uelcrén lessdsmploisvs mv&erd#8217;eaugmnteerra moroissatceeéonomiques ssusoep ile teslésdrte la Dalx deedohômag délevéeui safectu lrus td d50%Md la Rlpulatiqn éonomiquesent.dat verpéuprys, LIAtuéellment ,rl#8217;ii est imedu’énebqurttMd la Rlpulatiqn éonomiquesent.dat verpvitdvec lêins de#8217;énebdoleargméricains pr ljurs,lc#8217;est -à-dir n àe ous lduas ul 2e cparre aé /p>

LLscbudge l& la#8217;Érnée ffisalesd0113-0154 aadopi cor la RPa leent mtnpillt xl’irnée ffisales,dapté tésdrteeàSa pbaiqse,Mvul’inneapbccé cdeccolect teslaaxesneigd#8217;aimpôts Ls pépendsm de csaltre sdemrésentent Meièsau R90%Mducbudge l& lanciion ement C Ls budge l’anav sios=eent st ffinaceécarssu’en Htotlecé cpr la Dbal a r sl& lancd dlternationalux. Enu0154,Ln fcnnjugasonsàd tsrchsrsse, t

LLs rys,sgénèesHatuéellment eiins de m200 mtglwutesde#8217;Ééectiiqcté dour lun tlpulatiqn d Rrièsau R11villionssde#8217;Éhbilait s LIEnuoncséuesce, Mlsstftre réie sdprivéeseaïtienne. csot loliqge. àe#8217;éntlitan lessdénéraliiqcs erur lo#8217;eiltmetre en énergieelectiique .d ens le tccmdiaiqn ,alles asnt sévfeicie ent cmmpéioiivs evec l&s mcoû sau Rriodction nlsts délevés. Cs mcoû saan nt sexac b spar le#8217;eaugmntetion eotraesioveàe croixde poarbrsat C Ls Guvernement e pdcied cdecsurseoi làla psubventon uucroixde poarbrsat tftdve>uursldeuis q0150 /p>

WI cnnast pésumlt dne pnugmntetion e ponûtMd la Rvie.PPa lllèleent ,leaoeperéiétion desla prur dsts#8217;Ést paccélérén C AL pBanue d& daa épublique te#8217;Éaïti (PBRH)ds#8217;Ést pv&erdns le#8217;aoliqgtion Pu#8217;aiternveniraonttatment uirlespearch cdeccangesarur lout snqrl& Cvae urdesla prur ds C Jstu&s eàduattdla pBRHarur ra- - le lontrina. làliternvenir,Mvulu&erls césiiva. n te scdeccangesan sont sas pinéuis ble snbsp;?

WS on la s éonomiqste , n#8217;aéaitrn -cerls caanspaeo sden reoencatc d&ela pdtaserta,l& Cvae urdesla prur dspar lrupprt Pu duoleargméricains sese e t ieéjàdefancdrén CPardal a r s,lesprys,sadeéut éda#8217;Érnée ffisalesd0114-0155Msns lne rudge l&ûent voté or la RPa leent C Ls mnrniennld#8217;en fdtsciplnesffisalesdsusoep ile teslgrtitsqrl&ssdérands(éu&ilbér ranoroéonomiques io#8217;est pavéé coroliémaiques. s/br>
strong class="spip">4III. SUR LE PLAN SOCIAL/strong>& s/br>
Lsprys,sadcnonudqullues curcuèsasymboique srnoroirm déns lespdomnrnstsoiétl,lclteueJMichaële dJan /strong> res uél&erSctrétair Dénéral deeu’iOganisation dIternationale desla pranceophoie d(OIF),curcuédnt l l’aex-Pisident Msnérgalis pstrong class="spip">SAbdou Diouf/strong>& C L#8217;aéorivins strong class="spip">4YniscklLahnds/strong> rf emiprtaéda RPoixdFémintlenRrance .NLerColeèg lstrong class="spip">JCutesdPaesioir/strong> rretiet l’iutention Pdupaniende l’aéuctteon puirlesppla dlternationalelenRobtncat rdelhat s edosiqciion , /p>

WCeslnxliot dn#8217;ent sas pmipêch caïti pe ffigur ésr le plittldéescays,sas Dreu Carrre cdela#8217;ÉhpissphèesHoccdent ae LLs païti e aviv t.tans lunepsitution Pu#8217;aeterme leréiaroé LLLs preu Ccursagex dontrina.t d lrisuarrcl r slvis surdeslfrêe s epu&ifseàSa penchsrhe de leel a r tccmdiaiqn adepri dlx dIe s Turcsdn lCaïcos aa xpBahama ,n lMiamidn l dort-ogRico.

WC#8217;est pens ce tccmdiaiqn aouitiques ,eéonomiques in lsoiétlrssévfeicie qu&erl pays io#8217;evprrêt pàlucuseiles l’iAnée f0155 LIA cnt Ma sdueSa pprsière ficcuption dd pays ipr la D«nbsp;?Maicnesnbsp;;»2méricains ,ne s éli s eaïtienne. csau nt -lles as#8217;Ééecve làla pdtmetion ddelarr dussion ehstriique Mrur lévrem lénvtt ag ueSonslleue deeu& poivenriin aéee pays iou enrra- -nsàl toncirétsation de Drésirc on de slCss=atde ,pitnqMa sdprès ll larreile tre mbe mnt Mdeltrre Eeup12Sjanvle u0150nbsp;?

Ws class="spip">ÉMichl NSoukar/si& s/br> É88888

Ws/br> />

WPrssa le t7octobre 20154/p>

WPur lévouarrcl pmrt du Na#8217;Érnien cisc aeur dstrong class="spip">RJan -ClaueeCD vaioes/strong> ,dnus lavns lohoistaour u’Éhers a& drelny él lbnlsu toeescd lstrong class="spip">JLyoueesTarslleot/strong>&aablicédar ls class="spip">ÉescNnvelleittl/s> sa href="http://lmouvellesste.lnm/lmouvellesste/u toees/136651/La-mrt-adun-tigreau-Pteits-oes -pnis&lt;br&gt;&lt;br&gt;"class="spip"_out">http://lmouvellesste.lnm/lmouvellesste/u toees/136651/La-mrt-adun-tigreau-Pteits-oes -pnis/p>

Ws/a> ÉL pmrt du#8217;ane tigreaa ceritsdtès lpâis/ph3>

WPblicéde d05-10-0154iou ls class="spip">ÉescNnvelleittl/s> sbr> PardLyoueesTarslleot/s>

WJan -ClaueeCD vaioes tstpmrt . ens lls cées s ldns lls cfoyrse M& Bnnvelle po#8217;avpar dcrélceslgrand s émoion , CL#8217;ahmpm qsmbrenitààlpeie puivat CE ,leeuis qsnncemturs, ills#8217;Éctit lnnstlll déns lesprys,ag ompm ,deéjà,nunpfat ôm louduncrnaohrnsqsm CE ,lême lsi e tommresx citoyens vhïti e ant sexpéiméu&eeemgretéquele cmrt ,lueiao#8217;ast prsslun tsetente, Moie 1vntu dai séartnerrcl penddtéon deslcnprtesmour lds mvis s ld rbens ,RomsHvies,uomsHbens ,Rou cnels#8217;Éachlrn pàlvuvlir dje ésnncoaénvr tu xcchens . Cspreuleeàu’Éillictat efai eoivffriratai en fchos lu&erli ,ln lson pèesHaelt mai ,caeitrn poblicéenbsp;::ra mmrt du ve t itre celeue

LLs rrolime saec ll#8217;Éâm ,dc#8217;est équele cprsvello#8217;asnast pait u ue Mrur lc xpueiaymoroint COnarur raitcemiplac rlespeo por l«nbsp;?esprisnbsp;;»2oud«nbsp;?moiovteon nbsp;:»,doudenonr R«nbsp;?rersoneleté nbsp;;» LS se#8217;eon ttrn pàllslgrtde ,lhbilaueeColiqgn,dn Hénéral on peu plepfare (uitrreaar les cépithèt LDell#8217;Éâm on peu pdireaar lexsmpl. ue Mrancços le#8217;Arsios Na#8217;Érait bone.pt rFancços lD vaioes rustôtéaiuvis e,àu’Éille est pesRpue cesd& eombr s.NApcôé l&s mcria sdueS=atgcesd& es eaït s e#8339;rre sau Rriévaicairur ,dJan -ClaueeCD vaioes e aouv,sadren àaaiqséaueiaouv,srrre trit ,pmodesteésuvlageent ,ldelei srrêt lun tâm. Ss crhraes eas Dreu Ccélèér rienne.t d priircues LSouos class="spip">Épitt tig sestig/si&at Éks mnkaku& pl cpi rèd/si&an ttémoignrt ld lrie Pueiareovoien l’aidésad#8217;en frersoneleté COnadirai en canuvis pleèvedcntreaitsdd lrslrem ls pleçn dn Hlblics /p>

WL preagsirnde l’ahértéoe nbsp;: <Élufoarlson pèes, illhértémlu#8217;ane oivoir etaé#8217;ane oeuleeàn Hoaéeau LI cl#8217;aucuertecesd& vi.t inssidleeiement ereponisble tesrlt ma#8217;ÉHstriir .eSou lvingt-cinqMa sdu#8217;aetil. Cspn#8217;est équ#8217;ÉàSsnncemturs - m riépstrong class="spip">SPiéval/strong> reigviv la prancesnbsp;;! #82171;équ#8217;Énsàftrntde pur tmrn p«nbsp;?svpvoixnbsp;;»2ouv,sdneande ,lcandqdenbsp;: <«nbsp;?Qu#8217;Éraez-vuv,sfai edsTmonprys,nbsp;?

WCa ,le aouv,syuroumpn aoas.NJouets,dnus lfûmes,ue ljeu futlsoe oivoir .

WMai la#8217;Éhmpm qtstpmrt ,dn la Daun aoas.NResteéàpsioir ecnmint nl Doivoir atuéel gre ralsaoepersllen. TelSonmunaqquédleeue (unc«nbsp;?aïtien àauohenioue nbsp;:»2st suggre ne aoustllgieeirrepoctuéeus pdecl pmémoir b&s mvicsia sdueSa pfue rsau vaioésist, Mt runmpiitcip a& dress brentc dtès lsnuaiétat erur lnore luvenir.dJan -ClaueeCD vaioes tstpmrt . Nus ln#8217;aaen aoasRobtncuRusticc.,le#8217;ahstriir tstpinssidait u./p>

WQu es eréche in lsesmais le sreeue t CI cfautlsrppran lu&eleut frersone luylt mvcureauouscté d’inmor le l’iumtiqédaueiins de mqullues cus . Tut c lu&e2ouv,sdneandn ,sauDoivoir atuéel,dc#8217;est édepe pas pouv,simprsm ls pepersllen n lson pss=agmlompm qc xpe#8217;ane héros ae#8217;ane hmpm qeelhat s erntr. Cspe e issx cour urus lessdmrt . Pur u&i pu&e2ouv,se as rn aoasRobiqgesdescdnoncce làloanua cucuametionn,amis pseue ent.d l’avpreesdr ueoir &epmémoir . Pur ustrong class="spip">RGatelrpRayanie/strong> ,dstrong class="spip">SAugusteéThnons/strong> #82130;Ca s éonioes qd s Gonaïvs #82130;Cstdtat ueSmrt lsns cséplteue<. Qu es eréche ie lear&one.t lc lusgment.Sa pianir . É88888 />

WPrt-au-Prince, M19amis20154 sbr> sbr>/p> ÉUnutémoignag (uirlessprupprt stftre le smiranisation dlternationale .le l’itat hé#8217;Haïti /ph3>

WOnlouv,sadrsse, ceutémoignag (télériséed pPocfesiersSRioadoodSi enufu /strong>&,aspéiétlittldéeNReltion dlternationale .,de rrnien cRmrésenteat aspéiétlMdupSctrétaritigénéral ueSa#8217;iOEAd laïti . sbr> Enlévouaat tftdor toeuicrrcls pévéement gu Na#8217;Érnée f0150, ss fésvéltion ,dontesgném déns lespltrreas class="spip">ÉDie es pmprancss=osdIternatconalis/si&au’Éillvi.t d lftrescoaraîtren l’aUnoerseté deeSPiéval/strong> , pui lhele dui saéuitri e tre mbe mnt Mdeltrre ,drt docvicMdel"toeketaé#8217;aftreée"erur lnoiresad#8217;eONGoui son psupinssids#8217;Éassur én frlaceearveolégiéedéns lespealleag (-e ressdbéngce ttès -eéells -lduasystme sistatutionnueeshïtienn,ds lftrsat Palor,duncnoin lbnnconppt, Mt rlsvtt le r slancd dn Htot s bone.ponteien c. /p>

WLir la Rvidéo sbr> jirat getriso,leelr ue, ricfesorpScienufu , washingtnn,ahit i, sa href="http://www.yot ube.lnm/watch?v=gHGA-S-Cl-0&sns=em"class="spip"_out">http://www.yot ube.lnm/watchnbsp;? 00:30:43/p>

Wsspanclass="'pip"_doccent _1792 pip"_doccent s pip"_doccent s_oetrer' > />

WPrt-au-Prince, M20 févrle u0154 sbr> sbr>/p> ÉAffair dJan -ClaueeCD vaioesnbsp;:

WVértéble tcurpteslmasse dour u’Éex-isc aeur ,ltriss ns près lsnncemturs u#8217;aetil,lce lurrtedrur raitcrrre trsàe &,eusgmr,saui n lson régim,lucussésde#8217;eaoir ecmmuss u#8217;aitommreble sscria sdueS=atg /p>

WL pCur ue#8217;Avpreesdelort-au-Prince,oaéretdrdjeudi près -midi(uncrrrtelor&onelt ma mé réie pd ’innstrciion vdns lescadre deesmour sui s ejuiacoires eggtge. àar les cvicsia sdueSa pisc aeue (ontre la#8217;Hrnien Pisident Màlvi.,dstrong class="spip">SJan -ClaueeCD vaioes/strong> ,dqi pfar ia#8217;uibje gd lpeaitsesmour lcria slontre la#8217;Hhumnoté djugées uésrmatislrecsvtle s /p>

WLos qd#8217;Hne pnuden c.dtès litentdue aa cours de sa uella ra té trej aéerl#8217;iir&oneltc deucusgmlstrong class="spip">JCurvs lJan /strong> rui ,ln 0152,caeittest imédcntreaireaa ceeoi àaïtien à& Bnnion d& cria slontre la#8217;Hhumnoté sls risident Meuctibunal sls usgmlstrong class="spip">JJan RJrsnphdesbrun/strong>, aaeeésigné qsnnconleègumlstrong class="spip">JDrsinCD retéJnaqnr/strong> rour upretde ln Hohlrg ctte dnnvelle pnnstrciion /p>

WPlueiur srrnien ns cvicsia sduesrrnném dé lpemmr d prégim, depontque de cD vaioes (Fancços le MJan -Clauee)dompm qe strong class="spip">4Dr Nicoes Maglosr /strong>, aa msuciologumlstrong class="spip">JDnotèes Maglosr /strong>, onir&oneliiqcsdu pEnlect iflontre la#8217;Himpuoté sinssidu&e a s dpiensmrs de sleeoi sdhumnrns csscsit dréjurisd&elce tepdcieson dontesdéréndompm qun «nbsp;?ra déns lea bone.pdir teon nbsp;:» /p>

Ws class="spip">ÉAdcntreario/i> , l#8217;ane uesrrvoctisdu NJan -ClaueeCD vaioes, M strong class="spip">4Frtézo Catrn /strong>, aaeerntment erej aéea#8217;aurrteduele cCur e#8217;Avpreese rrnonccéàu’Éillillit lexerce lunprrsrvo pft css=tion .sp>

LCs ernisc -pionoccéàueleng>scaoisdprès ll pfi de la#8217;Érudtéon des Dreaigcat sdenamis20153- orre llvpvoi ààln sventéel pichèslontre lJan -ClaueeCD vaioes rftreépft aïti pftujanvle u0151,n l’aisse de#8217;ane etilde l2,las enRrance dui saeitteuitri e treovnrs ent ueSonsàrégim,lar lne suvlèv mnt Mepulatie<,l& p7 févrle 1986.sp>

Lspp/RidtosKiskeya />

Wsbr> sbr> Prt-au-Prince, M10 févrle u0154/p> ÉEnlect iflontre la#8217;Himpuoté sbr> Regrurp mnt Mdelreaigcat s-s D-cntre la#8217;Hetcisc aeur dJan -ClaueeCD vaioes t roncsmr s- etaé#8217;airanisation dd oeoi sdhumnrns sbr> Cftre l#8339;cceénque de coeoi sdhumnrns (CEDH) - Kay Fanm (Masonsàd slfepm s) sbr> Mnvelent.lessdfepm slaïtienne. cour u’Ééuctteon pn lasgdsvelopp mnt M(MOUFHED) - Réseaufationalelescdniensmde coeoi sdhumnrns (RNDDH) sbr> Pritsdfcalenbsp;: cedh@cedh-hit i.iras/a> />ÉEnmunaqqué sbr> 7 févrle nbsp;:

WL p7 févrle 1986,p&at d& da pchut d& da pdynasicndstrong class="spip">JDrvaioes/strong> ,dst pl#8217;Érbnui,ssnent ueSang>es s larreile srrnném dé llute dui son pmiprtaédd rellioes qdeHommpareioies /p>

LArès ll pbrutal Drérisqsonsau d28Rouvmbre 21980,dui saéor toeuicèr ent cileéle carsse,,tas Drpulatiqn dsit dàdnnvelaueisss phos -jeu LL Pflapm qeela mééssaantc lst péavivéepftu1984ipr la Djeun .,detdor toeuicrrcc xpeeu& pvrle duescGonaïvs ,nui sexpéimrt le r erej a ueSa pprsidence dhéésirtiir e l&uDoivoir absoluPui#8217;asle pimploue nbsp;: <«nbsp;?Apbaema missèr làlvi.nbsp;;! Apbaemaedohômag dàlvi.nbsp;;! Apbaema Btuntrs nbsp;;! Apbaema Bisc aeue nbsp;;!nbsp;:»2C#8217;est pl#8217;inndigntion Pu#8217;an epjeun .s leeuriiq nui sprtaece sme niees TonupsdueSbutoi làlusàrégim,lui soe, tnonr Raansparma le pseue bileioihèqe de#8217;ane cvrle àn Hoasrnemeour u&e tntrn amacut s /p>

LLs refusdueSa#8217;Himpuoté sour u’Éss=tqsoateMd ltriss éonioes q─strong class="spip">SJan -Robrnt Ciu /strong>&,astrong class="spip">JMakensn PMichl /strong>&,astrong class="spip">JDnotel Israël/strong> #89472; tuésdlor,dd ran&festationssdu d28Rouvmbre 21985déns lea vrle duescGonaïvs ,nst pleRferne cl tc d&ela pcntrepation eui semrebsela Djeun .p derierselesprys,.<«nbsp;?Qu#8217;Éoncrrrte,,tusgmlt roncdamn, Mààe crrissas Dcriainul aui son pss=tqsoaérls caarissjeun .pn lheli pu& saéonnnéce#8217;iir& edueleien luirlesppeulee,lême lsi c#8217;est én fds creu Caït s eït orté s ueSa#8217;Htat .nbsp;:»/p>

WCesljeun .paspirntrn pàlcea«nbsp;?ui#8217;asnfi dls d vaioésismesoie 1àpjamis pdralcoaé.nbsp;:» sbr> Vingt-hit na sdprès lce tepvicsore (uirlealtrre r le l’iolscrsat qsme,li.ofautlàdnnvelauefair df nt sour lcntre curue u&eeemturs ffecienlsdr u vaioésismest ra mvoangé dee

LCntrina. làlrefusn la#8217;anaucuertble tst pne ohoixqu&erl pstrong class="spip">JCnlect if/strong> reigbennld#8217;eauoes ,cciedn Haïti pe rrl a r s,lrt dréioluent oit .PAncnoineeu& pvérté de leeu& pusticc. IEnumémoir b&s mitommreble ssvicsia s IEnuhmpmag dàla mééssaantc ldeurus lcesljeun .pui ,ldrsat tcesl29las de mevc aeue ,dsit dénéraeus ent eiiné s auef nt sour l& Blbérnté.NRefusn la#8217;anaucuertble ,dc#8217;est éoite (vtrreaa#8217;Éesprispeup7 févrle /p>

Wstrong class="spip">JLs d vaioésismesaéét dne preagsirndour laïti nbsp;;! L#8217;Himpuoté Mo preu -êre le b&s tinhé#8217;Haïti nbsp;:!/ptrong> /p>

WPut-au-Prince, M& p7 févrle u0154 sbr> strong class="spip">JDnotèes Maglosr /strong>, sbr> Cnir&oneliiqcs É88888ÉKminicke sbr> 7 fevrly nbsp;:

W7 fevrly 1986,ps pdteMd ohoukay rejim bnuidicD vaioes (strong class="spip">JDivaiy /strong>,) a Ss rezlltalaspi.ol t batay dqfisil,lkot dplozyèrelly kntpareiyò soèd dlavi yo /p>

W28Rouvanm 1980,dynncempisqynncbrtébl,lki tepsitou sile tlprès ,lkebloa e oeyi a Aer lsa,dynnclò sfwalaskò sourvwalaleet tlpuiassynncyoMd yò nan jè ra . Flanm rezlaantsma mé rérnn fòsrrnu1984iak jèncyo,psitou si& pntncGonayivcyo,pki p mtran&k pvoyedje zafècarsziens lavi aiak eut purvwalgwo punyè raitre ne.t dèyèrli.<«nbsp;?Ab pl mizèlavinbsp;;! Ab pchomajlavinbsp;;! Ab ptoeienlmurnnbsp;;! Ab pévkationbsp;;!nbsp;:»2Endiyssynn,ps ptspeo èreoilitzssynncyon jens lki teprérnreov knu LAksynncjèncyolvin bay dènyedgwo bursadpntnckapot drejim lannbsp;:;

WSalki tepsitou anfamee jèns ll pntnceut peyi a,ps pespidt u. Jèncyole d&erefiz bat b pésvttlkeim ki tepkomè eoiv 3 elèvM& kòl ntncGonayivcpndeanran&festatsynnc28Rouvanm 1985ra . Jou sa a,pJan -Robrnt Ciu (strong class="spip">JJanrobè Siyi /strong>&),MMckensn PMichl (strong class="spip">JMckennsn PMichèl/strong>,) ak Dnotel Israël (strong class="spip">JDanyèl Izraèl/strong>,) rn b ensb Rbal.<«nbsp;?Sndourcyolae en,tuij pepi kntd t nilkeiminèl ki fèrkòlas asoatyeoiv 3 jèncyo,pnilchèf ki bay lòdleieneoiv pèpra ,lêenmsilchèf e psecpi gwo pueat pntncLetala.nbsp;:» Tè erèvMjèncyo,ps ptsp«nbsp;?rou sistmelutraiy is leaoe ohouk enjamèpntncoeyi a nbsp;:»/p>

W28Rl t ape (vtktw poivRl trrè ak fòsrfèrnw ,lêoilitzssynncobiqjemé rérnn rou br edwou pdiraiy is leaok apeemturnencofisyèlmac,epur fèrfa lkr edak voangéndourcgrtitsqpespidt u. Espidt u pou si& pki tepeet teut yoe oiuiassynncnsb Rbaburkèt,lki tepsimayeRl trrè. Espidt u pou si& pyolki teprérnrtou pdispozlayoe oiu òanisze sistmeluyaboiqklki t apeavilr,ltòtir ,las asoann,dvyoe ,dekzole,pdvpearèt,lvoaè,oe ohèpiyu. YolvleRfèMjèncjodi aikwè swadtzancemvoalayoe diraiy is leao u poteclibèt, Mtpndwismancak pwogès. Y apeeseys refè ak tòdyeRlistw ,lpur fèrkwè emjim diraiy is leaos ptspynncemjim kèlkntknbsp;:;

WKe b et ne fascele di Noe oiu s pki patksertbl,ps pyoe chwalKoe k iflknt sespidt u aifè,lêenmujan ak aspi.olò rrno Ayii p k aleaansj .

Wstrong class="spip">JRmjim diraiy is leaos ptspynncaanjedtaour Ayii nbsp;;! Espidt u palkab&s ten Ayii nbsp;;!/ptrong> /p>

Wstrong class="spip">JDnotèes Maglosr /strong>, sbr> Cnir&oneliiqcs />

W20ujanvle u0154/p>

Wstrong class="spip">JJacky Dnhomay/strong> rouv,saanspme tceslinrrmation s Ls pchos s burgnt.-lles aur tmrn nbsp;?< Oi srru -êre ,ln caomrn nbsp;?;amis pprès nbsp;?< Gar&onsaa#8217;Éespir ... ÉInrrmation s(uirlaïti ./ph3>

WQulluesfchos lale#8217;aur &epburgnrdn Haïti Sut u a xpdbmarchestftre réie sdpa ustrong class="spip">RSyri dBnjeux/strong> reige smiranisation dui seutent Meur lue tusticc.coie 1rntdue aaec la pout en àiternationale,tas Drssatid e ant sdneandéqu&erl ppichèsldmlstrong class="spip">JJan -ClaueeCD vaioes/strong> coie 1mmnéqàSsnncerre IEnurépn ,,tas Dd vaioésist,,sauDoivoir aec lstrong class="spip">JMcrtély/strong> rnt soblicéde plittldéescvicsia sdueSstrong class="spip">JJan -Brntrand Assatid /strong>, LDe cjurnateist,,s etignt Mue dusticc.coie 1rntdueqàSJan -Dminicue .dEnuorrett le ppichèsldmslss=tqsoasdu NJan -Dminicue ,nl Doivoir e olaceeespèr lfare (oblicrrcls pcria sdur u vaioésisme. Mai li.opsu pou raitcue dceàoie 1ne aouvelle pèr ui se#8217;uiuvr tnsaïti pe rue dceàoie 1ls rrolime sénéral ueSa#8217;iimpuoté Mui sdeve itre créglé Sns lesprège mnt Mdelce tepues ionn,aa pcnteien c.eouitiquesdcolect iv lo preu paeltcnrdens lceprys, /p>

Wstrong class="spip">JDs eréche ie#8217;Arssatid dsnculpé eour u&eeeeuriiedu NJan L. Dminicue /ptrong> /p>

WUnrangstrea àaïtien àadsnculpé1vntdredtaneuffrersone cour u’Éss=tqsoateMducjurnateist,NJan Léoouid Dminicue li.o lap14sans,cartmides uell creu iur srréche ie Na#8217;Érnien crisident MJan -Brntrand Assatid . sbr> Ue.hex-iéateiqcsdu por to Laella ie#8217;Arssatid ,astrong class="spip">JMirland Lbéréu /strong>&,ast édésigné or la Rusgmlstrong class="spip">JYvtkel Dabisidl/strong> rompm qea onmandertiir ur uoblieeeeuriiedu& saéonûtélea vrerl p3paeri.o2000aa ceir te urdeslRidtosaïti pItre entààln lgrtde ueSocurroé ,rs on la#8217;iir&oneltc de#8217;innstrciion . Mirland Lbéréu oaéreçu ir& e, bmacat rd#8217;Érssatid ,ad lftresctiir l tlpulatir jurnateist,,dontclu pleprupprt Psr le pbae de utémoignag sdreuseiles ipr la rangstrea . sbr> Lir la Rsui s...doudcloue luirlesplen àtnlbaenbsp;: /p>

Wsa href="http://hccovnrs as.blogpont.lnm/0154/01/ds -péche -drssatide-snculps -purn-le.html"class="spip"_out">http://hccovnrs as.blogpont.lnm/0154/01/ds -péche -drssatide-snculps -purn-le.htmls/a>

Wstrong class="spip">JNeuffsnculptionssduns le#8217;auffair dJan Dminicue nbsp;: <“L pvérté ddos tftfi duirgi ,du&trorz sansdprès ll ,sfai e#82121;/ptrong> /p>

Wstrong class="spip">JReprtae lsns cf nt eèess/strong> rfcuseileeMààe crrissaec latiosfat on et lpeuence d& Bnnvelle pdesfsnculptionss,nl D18ujanvle u0154,édepe uffrersone coutpçonném dé#8217;iimplqstion dens le#8217;aus=tqsoateMd lJan Léoouid Dminicue ,rl p3paeri.o2000aàlort-au-Prince, CL#8217;autentia leeuriiq rlontre laeceir te urdeslRidtosaïti pItre evait dtglesint nonûtélea vrerarcgrtden àe la Rsation estrong class="spip">JJan -ClaueeCLurissaite/strong>, /p>

W“Nus lsalun aunpry ejuiacoiressimprtaat ,lu&tsi paespéé carièsau srrnném dé#8217;asnli=eent sele#8217;iimpuoté Mans lunpdrssin lu& saue ioilit=élo ptvingstrea spnnstrciiurs CL#8217;asnquêt pvait dcrntestté trel tcé laec8amis20153saec ll#8217;Érudtéon dompm qtémoinie Na#8217;Érnien crisident Md qea épublique tJan -Brntrand Assatid ,donn llsspe uffsnculpé esit drépué s reohe CI cs#8217;Éage 1maitsecat rd#8217;Éétbler d& sdnoerlx deedreponisbllitaéeaec leréiésons,l l’avpri sde,sepersaiqn adespe uffcncce nés. Aucuncneddos tmanue rd l’avpreesour l& Bsui s ueSa pprocédue<. L pvérté ddos tftfi duirgi ,du&trorz sansdprès ll ,sfai e#82121;,doélamreNReprtae lsns cf nt eèess. “Tut cmpm qe#8217;aus=oiétion dstrong class="spip">RSOS Jounateist,/strong>&,aReprtae lsns cf nt eèesssdneandedetdor toeuicrrcu&eleut ll ,sdisposaiqn asoint réie sdpur lue tMyrland Lubésissepri nnsts#8217;Ésxploue lesrlt ma musticc.cueSonsàrys,.

LLs rupprt PeucusgmlDabisidllaanspms le s18ujanvle ue nieesMààe cCur ue#8217;Avpreesdelort-au-Prince,ofit dtglesint néat héesfsnculptionss denbsp;: RHaruid Sévèr /strong>, aa#8217;Érnien nstillttnte eLaella it lpetre sseprrudoudstrong class="spip">SA nstAugusti /strong> rteias<“Sô A n#82121;,danssidu&ehéesfhmpm steslmaoasdstrong class="spip">4Frntez<“ranceo#82121; Caellie/strong>&,astrong class="spip">JTutssaite M riédenu/strong>&,astrong class="spip">JMérté dMdlie /strong>&,astrong class="spip">JDimsleydMdlie /strong>&rteias<“TiCLur#82121; #82171; oélamrépmrt dor lcertaoasdtémoinenbsp;:-,dstrong class="spip">SJaudtNJan -Dnotel/strong>&rteias<“Guimy#82121; e Mstrong class="spip">SMarkingtnnPMichl /strong>&. Cs maarisse niees Ts#8217;Éctitnt névadésau Rrisonsàftuoévrle u0105,éde xcansdprès ll r larrepation /p>

WPuitiquesint ntès lset ile ,de#8217;auffair dJan Dminicue sprtaecn àtle pun tlplrssation deutjurs dtès lfrtaecït ourdesla prersone le Na#8217;Érnien crisident MAssatid ,dang>temps etilé pui lr vntuda cays,sn cmar q0151. Csrtaoasdtémoignag sdreuseiles ipr la svingstrea spt roncsigné déns lesprupprt Peup18ujanvle u-donn lheli pe Na#8217;Érnien cchlfàe la Rscurroé b&stJan -Brntrand Assatid ,dstrong class="spip">SOêeullJan /strong> r#82171; out en net ma mthèsese on la uella ra#8217;Érnien crisident Maue itsaui-ême lor&oneéu’Éss=tqsoateMducjurnateist,,dontesdérédompm qunetftreaeclàrs scvisém dé lemturs auDoivoir l’aperue du pcria . sbr>/p>

Wsa href="http://www.alterarsse,.ira/pip".php?u toees15829"class="spip"_out">http://www.alterarsse,.ira/pip".phpnbsp;? />

WPrt-au-Prince, MMntreéal (Canada),S5,ljanvle u0154/p> ÉDe xciranisation ddnonccet ma mlntenr lds mprocédue

WJounateas class="spip">ÉLs Deoir /i> , Mntreéal leS5,ljanvle u0154 12h16 | As=oiétieddPaesi | Actuleté dlternationale ./p>

WPut-au-Prince,r#82172; De xcimprtaat smiranisation descdniensmde coeoi sdesla prersone lnt sdnonccé, m riredt,ma mlntenr lds mprocédueRJan -ClaueeCD vaioes/strong> /p>

WDns lunponmunaqquédonmuna,dstrong class="spip">Sostrong class="spip">RHumno Rights Watch/strong> r/strong> reigstrong class="spip">SAmistrieeiternationale /strong>&rtffirint nuelra#8217;Érnien crisident ,preu Ccuonudsus lescnoineeuBébétDmc,eéohvpreeàSa pjsticc.càlcaussc«nbsp;?d#8217;Én cannue d& dvoangé douitiquesde leeudélis pjuiacoires naucuertble snbsp;;» /p>

WEnu0152,ln cusgmlaeitteu aeuéqu&erJan -ClaueeCD vaioes oivo t itre cjugémour lds mucusstion descdntursnlent.lessdfncd dlblicso,amis pvait drej aéeaepdrssin lprtaat (uirlesspviolaiqn adespoeoi sdesla prersone ,pittlt ma marsscripion . L#8217;asx-isc aeur pcntrepaela Ducusstion descdntursnlent.,dtatdi qu&erl Dreaigcat sdfon pspreesdr usgment.Sprtaat (uirlesspviolaiqn adespoeoi sdesla prersone /p>

LL#8217;Érnse niees,aa pcnr ue#8217;Avpreesohlrgé ur uossin laàftrntdurls caémoignag sdeslM nbsp;:D vaioes t rdecreu iur srvicsia s,oui son pracngé daoir eté ttuntrsé cout lesprégim,leeuBébétDmc,ed 1971càl1986. L pdcieson d&ela pcnr ue#8217;Avpreesst ésuspntdueqeeuis ql caoisteslmao,detditentdat tceraines fprocédue

L«nbsp;?I csmbre lu&erl Dït orté s aïtienne. cn#8217;avi.t iucuneamnention d&elmeneradespsnquêt s ethastica. uirlesspabusecmmussldrsat ta#8217;Éèr D vaioesnbsp;:»,da oélamrépstrong class="spip">JJavle uZnaqga/strong>&,ad#8217;Érmistrieeiternationale ,vdns lescanmunaqqué /p>

LLs rrsident Md#8217;Haïti ,astrong class="spip">JMichl Mcrtuley/strong>&,aadeéjàddi équ#8217;Éillctit livenrteàSa pprssillitaéee#8217;Avccotde aunpryr&onqàSJan -ClaueeCD vaioes, dns lescadre de#8217;Én cvasteéeffrt du Nréonocilétion dationale CI canlsts dtffiriéàu’Éillr vntit lauasystme sjuiacoiressee

LLs rritcipal usgmlohlrgé ur uossin ,dstrong class="spip">SJan -Jrsnphdesbrun/strong>, ao#8217;avpar dpuitre cjoitsdour lcnmmetre ee psitution /p>

LJan -ClaueeCD vaioes, utjurse#8217;Éhi éâg b&st62sans,cst pé vntudtnsaïti pleS56ujanvle u0151,nprès l2,las u#8217;aetillenRrance ./p>

WI cn#8217;avait du&er19las duattdll saéors le srivoir arès ll pmrt du Nson pèes, Fancços ,ddi éstrong class="spip">SPupltDmc/strong>&. Humno Rights Watchest im lu&erl DD vaioes oèr e lfil pot lor&oneéu&eeeeuriiedu N20 000aàl30 000acveolsldrsat ta r erègn tesl29las /p>

LL#8217;Érnien cisc aeur daofit dreu iur srouticns ublique s eeuis qsnncemtursdn Haïti Illctit lnoatment résentedlor,dd#8217;ane ccérémoie drur loutlinerrcl#8217;inndépntdatc de#8217;iaïti ,aleS5rrcjanvle , c dui saéuiscté d& slontdamnaiqn adespreaigcat s CI cs#8217;Éaffair dlsts dàNréouvm én frsidence dà Péiqn vrle ,àtnlbanlt xedd lort-au-Prince, /p>

WPa ustrong class="spip">RTrrt nncDnotel/strong>&/p>

WPur lvccompanerrcce lurtoees,li.ost pbn d& espreertae da ctext,lcmisdpa ustrong class="spip">RHumno Rights Watche/strong> reigu&e2ouv,saanspme rn aaco. sbr>/p> />

WPrt-au-Prince, Mjanvle u0154/p> ÉDesmiranisation ds#8217;Ésxpéimrt lontre la pbaateistion desSa#8217;iimpuoté Metd&eeeérisonnuisme

Wstrong class="spip">Sos class="spip">ÉDélamraéon domnjoitselontre la présentc le Na#8217;Ésnculpé1Jan -ClaueeCD vaioes u xccérémoie s ffecienlas Dd cjurnle Na#8217;Ésndépntdatc de#8217;iaïti /si&a/strong>&/p>

WDoccent loutmisdàos class="spip">ÉAlterPaesil/s> <& p7 janvle u0154/p>

WNus lsigntiires delce tepdciamraéon ,lissusdueSa p=oiété tcveole aïtienne.nnganisae ,dsipm stricfntdéent lnndigné ipr la présentc leucisc aeur d&échupstrong class="spip">JJan -ClaueeCD vaioes/strong> ce du Na#8217;Éextillttnrescoutschist,Nstrong class="spip">SPiospnr Aeri./strong>&,asu ditvittion dd pPisident Mn àtxercie,ostrong class="spip">RMichl Mcrtuley/strong>&,aa xccérémoie s ffecienlas Dd cstrong class="spip">Rjurnle Na#8217;Ésndépntdatc de#8217;iaïti /strong>, aaeS5rrcjanvle u0154 u xcGonaïvs . Cstteprésentc le srrnien sttuntonnuires st én fricvoction et luneamnslte dsnuaaiofible tà & pnteon . Ele tst ptglesint nuncrff nt sàcl pmémoir b&s mellioes qdeHvicsia sdueSa pisc aeue (d vaioésist, /p>

LJan -ClaueeCD vaioes tstpitjurse#8217;Éhi ésnculpé,àar lesrlt ma musticc.caïtienne.,mour lcria slfinrnienrspt roria slontre la#8217;Hhumnoté .dLs evicsia s,ouylt meggtge eesmour sui s ecntre la#8217;Het-isc aeur ,litentdnt Mn onr Rn fdcieson d&ela pCur ue#8217;Avpreesar lrupprt Pa xccria slontre la#8217;Hhumnoté nbsp;?;acria slimprsscripiobe .le lnnncnmistritle s /p>

WL musticc.co psiue t itre contfntduepaec lla vntgette, CCscsit das Dd vaioésist,,se le r sltntrn amacut s eui son pmuql caonoouis ueSa pviol tc de#8217;itats aaec ltut c lu&e2cea pimploue CI esit dustqu#8217;ÉàSrésentedrictégé ipr la#8217;iimpuoté Msystéiquesnui spiévautdéns lesprys,.dLs evicsia sdueSa pisc aeue (eige smdpiensmrs de sleeoi sdhumnrns,Pueiao pontfntdet sas préonocilétion de sdno pe Nusticc.,ls#8217;Éinuirgrt lontre la pbaateistion desSa#8217;iimpuoté ,d&eeeérisonnuismeehstriique Me letignt Mue da pCur ue#8217;Avpreesrntdetftfi du pdcieson ,pontfnriéent.d lsn mndea it lpr lrepoctueour u&e vicsia sdui son pcursageus ent eprtaédpeaitselontre lD vaioes /p>

WNus lvpreeon ll ,sdifférnt s p te ursdueSa p=oiété tàlrefusn la mééhbllitation dd pu vaioésismest ra mbaateistion desSa#8217;iimpuoté /p>

WPut-au-Prince, M& p7 janvle u0154. sbr> strong class="spip">JOranisation dsigntiires /strong>, sbr> 1. Cnlect iflontre la#8217;Himpuoté sbr> 2. CEDH (Cftre l#8339;cceénque de coeoi sdhumnrns sbr>) 3. 4. 5. GARR (Grurp ue#8217;Avpr& sauxlrupteiqé,se lréfugqé,) sbr> 6. Kay Fanm (Masonsàd slfepm s) sbr> 7. JILAP (Cmmussson dépiscopnis Jsticc.ce lPaix) sbr> 8. MOUFHED (Mnvelent.lessdfepm slaïtienne. cour u’Ééuctteon pn lasgdsvelopp mnt ) sbr> 9. POHDH (Pl trarma lessdiranisation daïtienne. cescdniensmde coeoi sdhumnrns) sbr> 10. RNDDH (Réseaufationalelescdniensmde coeoi sdhumnrns) sbr> 11. SOFA (Solidrssaédd rfepm slaïtienne. )/p>

WPur le smiranisation dsigntiires e luuoheniofqstion strong class="spip">JSylvrerW.dBnjeux/strong> , Dir teiqcsdexcuréive CEDH sbr> strong class="spip">JPirre Espéétte,/strong> , Dir te r lexcuréif RNDDH/p>

WSutrcsnbsp;: http://www.alterarsse,.ira/pip".phpnbsp;? />

WPrt-au-Prince, Mctobre -ouvmbre 20153/p>

WPur leut lcnlas Ds laus lce xpueiasit dnatéisqsés,dnus l&onen aacolvccèssàcl psetente,dd pTibunal Md qea épublique tdminiccines./p>

WI ctstpn onr Rdifficie teepdir tsilc pontflt trivenrapoblnnncn frspn ,lrupiendens le#8217;alteérêt eesmoaticns. Csrtaoae voixqdminiccines vontdens lcepsns ,Rmai li.ost pc rtaoaMue da pvigil tc d&ot itre c&elms e,àe ln preu pesprelâhe rdne seullnnstlnt. sbr>/p>

LLs préat on slontrina.t Md#8217;Hrffle larès ll pdcieson dinque de da pCur uonteatutionnueel tdminiccines l’an ontre lé s Dminiccaoasdé#8217;airigin.caïtienne.. Voacold#8217;Hrbordlhele d&lra#8217;ÉrnthroouiogumlRachlle dCharioes Douct lpr undens lAlterarsse,, pui lhele dui sbmac,dd ps te urdesla pClteue sa href="&lt;br&gt; http://www.alterarsse,.ira/pip".php?u toees15247#.UlCO-Gwo7cc"class="spip"_out">sbr> http://www.alterarsse,.ira/pip".phpnbsp;? sbr>/p> Éaïti -épu. Dminiccaoasnbsp;:

Wsamedta5Mctobre 20153/p>

WPa ustrong class="spip">RRachlle dCharioes Douct /strong>&/p>

WCmpm qtat rd#8217;Éauoes ,cj#8217;avi lusaec latupéfat on ece tepnceroyare lnivelle nbsp;: JCnr uCnteatutionnueel tdminiccines/strong>&,adns lunpdrccent lu Rrièsldml147lprg s,outtundurlspcuréàpsiRpeoer lonteatutionnentààles epeoer dloistmigrariir s,l lrus lessdpiitcip sdmrtauxln laégauxlauxuell ca#8217;ÉEat héminiccinecanldhéés,l lrus lessdvccotd ,dontvntion Ds lae t dlternationaluxlauxuell ca#8217;ÉEat héminiccinecst prsticnse lreltiofsmauprepoctuee sleeoi sdhumnrns,Pe sleeoi sdcveols,douitiquess,eéonomiquesspt rolteueéluirlespsolhéminiccinenbsp;:»2(uella rsurerbe triverl a nbsp;;!),Na#8217;ÉEat héminiccinecrisue de ds leetre lau brsàd slnaiqn adémocraique ,detdrésirtit.lessdpraique fascist,,,st ra mcréaion Pu#8217;aarstiheidluirlce teppuntonnPu#8217;aîl /p>

LL#8217;ÉExcuréif éminiccinecli ,lacgrtd dnedlourdlill tc .RRubs HSilié/strong>&rt sxploueéSa pprsiion desSa#8217;iExcuréif éminiccinec«nbsp;?SE PA NOU, NONnbsp;;!nbsp;:». Ohgu&e2ounnbsp;;! «nbsp;?I cnsts#8217;Éage 1pa,dd#8217;ane cdcieson d&u givenrnlent.leminiccinecui sestsaui-ême lpréoccupénbsp;:». Finlesint ne smdpiamraéon sau strong class="spip">SoLeoueesFrnattdez/strong>&rà New Yorkpn lhele d&uàlésident Mstrong class="spip">SDnotlo Meoint/strong>&rheesMààSatrncDminigopontfirint na ppritiquesdueS«nbsp;?aaiqsez-fair nbsp;:»2&u PLD CI etir t ueSa ur ran&he ie sme xccantesthblltella nbsp;;:Cc

LCs tepdcieson dst éellesent.laberrantsde sdncncce aat s ui#8217;asle puisctéeleut louti. cescsrpputtion ,du#8217;aaaleyssspt re#8217;Éhypothèses SiSa pplurstile srrnleys lo#8217;Avccotdet (uirlesscanat èr alcostsde sdiscriainteoir uelealeesue ,dservtt le dlteérêtsd&lra#8217;Érie tltera-ationalesat tdminiccines,lcertaoasdypvoi t.lessdanₓuvr sdouitiqien ns ccntreadicsore s,àoie 1our ldiscrsirtes t rdéittilit=e u&eegivenrnlent.le pPisident MMeoint,àoie 1our lcntreôlrrcl#8217;iéect oen it lassur éa méééect on desSa#8217;iex-lésident MLeoueesFrnattdezen c0156it lprre trsàau s te urdnéo-ationalesat titsq-aïtien à&epsorsqrlssspgriffe dn Htot s ui étud .Rranceisco Peña Gienz/strong> ;! Pur lcertaoas,lealeesue dd da pCur uCnteatutionnueel tvrs rit lauts dàNéludrrcl#8217;iobiqgtion Pait u àca#8217;ÉEat he Pa xcftre rénteursduminiccaoasdéspryse u&er ldûse le r lprnson da xcreaerl a r sàaïtien s. Quoiàu’Éilln àsie ,ll pdcieson dd da pCur uCnteatutionnueel ,djugée irrecsvtle lar lneeBgrand danjoroé b&sta pppulatiqn tdminiccinessaéorovouaédd riemuv,ée.lessdan&festationssdn cRpublique tdminiccines,aàlort-o-Rico,rà New York,st rdas u#8217;aauoes rays,soùla pdiasprtatdminiccinessst énoires sm.d«nbsp;?L s Dminiccaoasdés bone.pfoiàveue n éoite (saoir eaueiitdetfttcrrcu’ÉilscnstseRfernt sas pcomplic lé#8217;ane ctlle pnnqueté nbsp;?» /p>

WCurieus ent ,lce tepvagesdueSrictepation en#8217;Éage pas pronpSa p=oiété taïtienne.,m«nbsp;?tqsos (uirlun dblocsee

LAla pdifférntcelé s Dminiccaoasdéeurus lâgsspt reeleut lcatégoro louiétlrsdui sfnt sestetde la urdvoix,upretnrt le r epluen,louti.ntdens llrsdressit ls leoilit=rt lontre lce tepdcieson dinque de da pCur uCnteatutionnueel ,daurinte-nou dprrdblnnre lcuptctaéee#8217;Anndigntion Pn lu#8217;aemparhienbsp;:? Ou s e t -cs uistno epeoer dpraique discriainteoir slnou daveugl.t iuprritsdde2ouv,sfare (oblicrrcu’Éills#8217;Éage 1d#8217;ane ccnmunaauoépaec llauella rnou davn aunelfiliaéon ,lunchértébgege.lessdlen s olteue Mu qsmedsnuaaiofible tftu1937,Rmu qsmedsnucuertble ts c0153...

Lhttp://www.alterarsse,.ira/pip".phpnbsp;? />ÉPROTESTATION DE

WNus ,pitnéast,,,ssticst,,,shmpm ste lfepm steslolteue

LEnueffet, c dui spou raitcearaîtredompm qun actepdcmfttcr Md qtemps rpvolus,pri n du Ns#8217;Avccomplisdn Hviolaiqn td qea Délamraéon dUnoerrslle pdesfDeoi sdesla#8217;iampm ,Pueiaeatpue ts csoncrrtoeesS5,lu&eleut lnndivi&uDaceeoi àà1ne aoleon alté Meigu&e2oulln preu ptre crisv b&sts pnteon alté . Cst actepd da pCur uCnteatutionnueel ,dnou drvpreelerl Deesue sdui son peréiéd da Rgénocien,tftu1937pdesf30.000aaïti essgmassacré ipr la risc aeur dfascist,,dstrong class="spip">SRafar MLeouidrs Trujileo/strong>&,aémue té#8217;astrong class="spip">RHitles/strong> CE lreu Créinmint ,da Rgénocien rwndeas pvpté teréiéd de#8217;iuncclimaipsimiatir àlheli pu&elcertaoasdp te ursdalcosts e lxénophobs voudrntrn pcréerdn cRpublique tDminiccaoas /p>

LLssaaïti essgeige smdpmocrai sdd piitdetfttcrrcn preuvnt Mue doncdamn,r1ne aeesue da ts ddnsgsreus peut ln àtxigetttqsnncemtraitcearda pCur uCnteatutionnueel tDminiccaoas /p>

LNus le eandn aàleut ll ,siranisation ditsqracist,,,sitsqarstiheidle leeudéiensmde coeoi sdhumnrns anssidu’ÉàSeut ll ,snnstlnc smdpmocraique duDiitde,dueSa ve u&er cvoixqour uoncdamn,r1ce tepeesue deut ln àtxigetttqsnncemtraitcimmédiaé oule boycotébgegds mprodui sdeminiccaoasdf l&uDtursqsmedens lceprys,gu&e2oulldpmocrai se rrnsqracist,cneddeve t lreu Crisoterdn csolidrssaé nec lcssdctoyenssPuminiccaoasdintacésau Rbanuiss ent epru u&er lirigin.cracitlre. S.V.P. dre qsezcvo Deessag sdaunbsp;: sbr> sbr /Ws mg src="lcale/cachl-vinerte s/L8xH11/puce-68c92.gif" width='8' height='11' Palt="-" style='height:11px;width:8px;'class="'' /Wnbsp;:Pisident Md qea épublique tDminiccines,astrong class="spip">SDnotlo Meoint/strong>&, PalacioMd qea Paesdenceia, àSatrnccDminigo, àépubliqcatDminiccin . Fit us-li sparvntircvo Deessag sd derierseles dambassadestd qea épublique tDminiccaoasRens lvo Drys,grepoctuofs. sbr> sbr /Ws mg src="lcale/cachl-vinerte s/L8xH11/puce-68c92.gif" width='8' height='11' Palt="-" style='height:11px;width:8px;'class="'' /Wnbsp;:L#8217;ÉApbassadeurdesla pépublique tDminiccaoasRs Haïti sstrong class="spip">RRubs HSilié/strong> : mbre pumihai@yahoo.lnms/a> sbr> sbr /Ws mg src="lcale/cachl-vinerte s/L8xH11/puce-68c92.gif" width='8' height='11' Palt="-" style='height:11px;width:8px;'class="'' /Wnbsp;:Le Pisident Md qea épublique td#8217;Haïti ,astrong class="spip">JMichl Mcrtuley/strong> : <dir_rh@mae.give.hts/a> oullsts dtunbsp;: <

LArnuid Atrn in sbr> Dir te r l&uDCftre lPeiqn -Bolivar Pisident Md qe#8217;ÉAs=oiétion dHïtienne. e rCnteeileerdeslaAHCs/>

LMoïsmdCaellie sbr> Pisident Md qe#8217;ÉAs=oiétion daïtienne.a&s mctnéast,, (AHC)/p>

WPut-au-Prince, M& p23 Otobre 20153. />

WPrt-au-Prince, M25lo ptmbre 20153/p> ÉDélamraéon dd#8217;H#8217;iuncgrurp ueelpr esent.ires aïtien s résentessàcl p43me sssqsonsrrnnuele d&uàBlackdCaucus,l lWashingtnn

WText,lsine b&utséateersRSt vnt Bennit/strong>, sbr> Pblicédee1vntdredta20lo ptmbre 20153/p>

WHonoeble

WWelae taking ihe opprt uotéy of ihi CrisotDtucbrtef youln dsoe lof ihe vntesstha àaïv Rbrurght Hit iln dihe ersg lof adanjordouitiqialacrisqs Aelesgisltrorsrrnd belieerseli dihe empisqntia onsrof ihe peope

WFoiemus ,dwedwouid likeleu s aeustha àwelae looking art wys,geu eov ahead with Mr nbsp;:strong class="spip">JMcrtuley/strong>&geuward ihe oranisza onsrof e eocraiqc,sfare,saansprarnt eect on slssdui cklylssdprssilleleu fllidhutdreds ffdprs s at ihe lcaleSa velrrnd i dihe Sentre (10lo ats) Aelesgisltrorsrwedwouid likeleu maitsinecanstble touitiqialaclimaierrnd workpi daïriity with ihe xeuréive béttehleu atreactcnewditvestent ,acreat,cnew job,,ssussinebllitayrrnd keep ihe hop sdof ihe Hit itncoeope JMcrtuley/strong>&ghr duhownsaéorofoutd dislikelart e eocracy,Rlsgisltrive Rmpisqntia ov,,,sisrwelida lfrt ihe chlckrrnd bal tc dof ihe powess grantsdleu him by ihe cnteatutionn. Currnt ly,Rmunicipal guvm nent lns being macagsdlby hand-p cksdlent ttdlwient totaley e iacitsdleu Mcrtuley. Thi Cmens ltha àale 420lmunicipal xeuréive agntessemplacing ihe eect sdleayorsrwhos lerreghr dexpresd,psi c.e0151,npredolos lMcrtuleytouitiqialaalioes. Thus ands ffdeect sdlcoutéy officialsàaïv Ralsucbeen hand-p cksdlby Mcrtuleyteu emplacusthos lwhos lerreghrd runuort. Paesdenct Mcrtuleythr dalsucdn eàale he cnuid eu hïv Ra hand-p cksdleect oenilcoutcie he hop d cnuid rigdihe ectep i dfavrt ffdhcsdouitiqialafren ds. Thelarllowing s pvpsummarydof ihe cittion ditdlemhtéblslof adaesoltionnepeoeos d by ihirtus Haït itncCntge qsent eu hïv RPaesdenct Michl JrsnphdMcrtuleyterend by a HighpCur tlof Jsticc.cssdprsscrib d by iheuCnteatutionndof ihe coutéry. Throrghlthi ,dltcissprssilleleu ge rr guod,pbt lnncompl en,tview of ale ihe eiolaiqn aof aït i#8217;isma w ditdlonteatutionneby iheuhighst émmbress of ihe xeuréive béttehlof ihe coutéry. Amng cother thing ,dPaesdenct Mcrtuleythr dbeen ucuss d of eiolaiqg crrtoeesS5,3lof ihe coteatutionnewhen heterend eu dispos Ra neighbrt ffdhcsdoisvatedrepdence dffdhcsdhus errnd surroutdqg cpeoeeticns by using ihe eui val.t of ihe IRSleu fblselylscuss ihe nndivi&ualaof notceayqg cpeoeetiy iaxes Aeler eylssdOtobre u06,e0151,nPaesdenct Mcrtuleytotde d orluuohorized ihe arrepalof adaït itncCntge qsean as hetst,pp d ut lof adpl t arllowing an official ussson dabruad,dltHviolaiqn tof artoeesS514.2lof ihe coteatutionnettdlwithut laty lsgal groutdleu ac lnn suehla wys. Hsplendettdlencend eha àaeghrd atything eu do with ltcwhie tltcisswelidknownseha àai lhrllrbortrorsrrr lerrrifend by him ttdlwiuid n ve uac lwithut lhi Crporoval.RLaurnt Lamothe/strong>&ghrvelontreolaover thos Rfunds whiehlsurpss= US $200mellion deudys. Hsphr dbeen érying eu ge lParliaint ntu etiofylhi Céeieson at prs erioriq#82130;/p>

WPaesdenct Mcrtuleytilsucviolaindetrtoees q010titdl236aof aït i#8217;ismcoteatutionnewhen het&s igntinde(Januaryd24,titdlJne a15,e0152) hi Cwiferrnd hi C23-year quid snnceoponotdinaierrnd macagsmellion s of US drllrseli dubliqcRfunds itdleu dsoiétlrrnd spors Céevelopent réograms ut sden of ale lsgally-estblersh d channels Foilo enralpeotrh ,dontreactsswere grantsdleu compaie s fwnnd by o uoncnct sdlwith fren dslof ihe Mcrtuleytfaellytimng crumoss of ellion s being k cksdlbackdeu ihe wiferrnd snnc(ihe latterdi lhurrnt lypbtildqg camellion ddrllrs-ompm riétlrbtildqg ci dn eàof aït i#8217;ismmus dexpet iv lo ighbrthuods When ewo aït itnclawyess fie dlaplsgal complaitsdagaoast ihe Mcrtuley ,dihe Dstreic lattorgeysrnd ihe nnvestqgtiog cJudg lemheived thr ats. Finlely,Rihe nnvestqgtiovecJudg lucuss d iheuChtef Judg lof ihe Cur tlof 1st Instlnc lof iaking him eu aémmeiog cwith Paesdenct Mcrtuley,lPéimr1MiistresJJan RmueesSanon/strong> CTha àwr daclaearHviolaiqn tof thessnpmraéon dffdprwess undes aït i#8217;ismcoteatutionn. But thing swet evnt further s prhe nnvestqgtiovecJudg ls aeud eha àPaesdenct Mcrtuleytidre qsed him disrepoctufuleytitdlthr atened him rnd summnged him eu stopprhe nnvestqgtion dffdhi Cwiferrnd snn. Thelnextdeny,Rihe Judg ltuid hi Crs=oiéties eha àaegwiuid abandn prhe nnvestqgtion drnd aeave ihe coutéry. But aegwas eu die ihe eny aft,r1nedes mys eriou mctrcumstlnc smeha àremaitDtucbe sxplaoasd. Both ihe Cntge qssrnd ihe Sentre nedestookrrn nnvestqgtion dffdihe matterdeha àrritss eu eiolaiqn aof thessnpmraéon dffdprwess by iheuaeadess of aït i#8217;ism xeuréive béttehlrnd iheir MiistresSA l Jrsnph/strong>&rhe lhhiedhuod fren d),mstc.,nPaesdenct Mcrtuleytrnd hi CMiistres

WL t ébu lnoa aeast,daclaos lfren dlof ihe Paesdenct cameleu prt Pwith 55 packs of earijuaca n dhcsdoisvatedyatcheitdlolee d iheuouitc.citdlihe Dstreic lattorgeyseu com.citdlgeidihem at hissbeaehlhctel When ehe Paos curorlhrd him com.ceu his office frt ue iqn eg cand l trr<=rt lhim eu aéDstreic lAttorgey, iheuouitc.cspokepocrsn drnd evnt ihe MiistresJMcaqgat/strong>,lwae easoes und heàmny aïv Rwo ài . aït i#8217;ismuuitiqialaclss= letpMr nbsp;:Mcrtuleythrv.ehi ldys,gfrt iwolyeass,resspe pwarning ignsmeha àihe ma àwr da drdmien lund arllowesRrancços /strong>&rtnd strong class="spip">RJan -ClaueeCD vaioes/strong> IndeedcPaesdenct Mcrtuleythrdto enralprun-i dwith mmbress of Cntge qssrnd of ihe Sentre were he cler eylsaidàaegwiuid rtihs ueu dihe coutérylwithut lalParliaint Aft,r1iwolyeassdffdhiderrnd seek firstpeu pulersh iheénintdent s of ihe coteatutionn, ihen eu armada deect oenilcoutcie, ihen eu send ihe eect oenillawceu Cntge qss(he k ptvihe erccent lfrt iwoleotrh at ihe palace),nPaesdenct Mcrtuleytwit edlfrt ihe lcwes

Wstrong class="spip">RLng clive HAITI,dang>ue ei Ra nnre lcheessHAITI /strong>&/p>

WSt vnt I. Bennit Ecut sz-nou dsr ueeeande Ecut sz-nou dn cisr tenbsp;;! sbr> aïti -Slamnbsp;;:CSoiré,r#82177;Spassh#8217;ilà ThelBackyard sbr> aïti -Prévntion grosssqssnbsp;: ue drsé eour u&e faelliesdeéjàdcomplèt ./p>

Waïti -Séqsme-Deoi sdhumnrnsnbsp;: />

WPrt-au-Prince, Mo ptmbre 20153 sbr> sbr>/p> É DÉCLARATION sbr> 5

WLssastrong class="spip">JOranisation dd qea Soiété tCveole/strong>&, llrsstrong class="spip">SoOranisam steslDeoi sdHumnrns/strong>&, eige smstrong class="spip">SctoyenssPsigntiires /strong>,b&sta ppésenteepdciamraéon ,loncdamn,tsdaec lvéhcmfte, M& pcomputi.ent /p>

Wd csiclass="spip">WPrvoir Excuréif ueiaa/s> sbr> a) eeuis qes xcns lblouaédledpiocessusdéect oenl,Rrisvat anssidl preuple aïtienndd pueoi àsacréee#8217;Aélte (s dirigettt dloclx dn lsesmempisenteat s aueSéate sbr> sbr> b) pntdat tqes xcmos ,drefusé,tftudépiile srrpree CrépétésdueSa p=oiété taïtienne., dueSsaanspme rrsàau Pr esent.dledpioje du Naoidéect oenle emmisdpa ue dCrllège Tins itoir uurCnteeil Éect oenilPermac,t ,lcomprome rat anssidSa pprssillitaéeeelréait=e ués bone.sdéect on dpvait na pfi desSa#8217;ianné 20153. sbr> sbr> c) itentdulla vniel td qea réunin tdupCnteeil d qScurssaédd rNtion -Unis ,dour ufinlesint nrmen rrsàunmpioje du Naoidmodifié, mntreat anssidsn méors lricfntdeour u&arNtion daïtienne.aetqsnncltention d’Érpadou ta pcnmunaauoépiternationale /p>

Wd) n visagé, dns lescbu leelretde linopéétt.dledPrvoir législtrifle leeus#8217;Av rribueraunmpivoir absolt,du#8217;aécursre ee pdrsé eduDindea iduD2me stoes qdueSéate,tftu évouait na paoidéect oenle 2008,ldns lune dispostuonnetins itoir u vntu tobsolètn,tfturasonsàd slretard dn rsgistré idns lea iene de céect on ds c0108mst enc0151,nchauelpfoi ipr la pfat s de,sdifférnt s dirigettt dftu olace /p>

Wdecsiclass="spip">Wcsrtaoasdrstesent.ires uei/s> sbr> a) ao#8217;ant sas psuls leonre rsàcl phat surdeslaeurdmiqsonsrst on peréféré servirSa#8217;iExcuréif plutô Mue d’Érretrer(s dérives /p>

Wb) on pvotédledpioje du Naoidd dfinrni cour u’Étxercie,o0153-0154,Pueiareu paoir &eplourdesccnteéue nceslour u&e curhe ie smreu Cdéfavrtésé, d&uàlys,./p>

Wd csiclass="spip">WPisident MdupCnteeil Supééi r l&uDPrvoir Juiacoires/s> sbr> ueiaeeeonles epairs,daofit dobstrut on ààma musticc.cenlblouaat ta#8217;Ésnquêt discipliuiresdinqtiédpa ue dCSPJ, dns lescadre deell pmrt dsube p&uDJsgmlstrong class="spip">JJan Srsg lJrsnph/strong>&,àsacrofibt anssidl#8217;Anndépntdatc deuDPrvoir Juiacoires /p>

LLssasigntiires dela ppésenteepdciamraéon lréaffirint naer lvteachlent lnndéfct ole dlx dpiitcip sddpmocraique d#8217;aéueilibe (eigd#8217;Anndépntdatc deesmouroir s,dausfntcionnueint nréguioes t rsns cinerrrupiqn tdupPr esent.dompm qnnstlnc teslontreôlrdn lseullpivoir hbllita tàllégiférns /p>

WI e l tc t nuncrpreesae qsbt /p>

Wa) auàlésident Md qea épublique tpur lue#8217;Éillrntoce dà tot s tntia ov,de#8217;iusurprrcesspouroir sponteatutionnueestdupPr esent.de leeudirigeràar leécretMeigu’ÉillupretnrSeut ll ,sdispostuonns nécessires pur lue de céect on dcrsirle s,shmnnêts e linceu ia. ntrn plieu dns lescmel a r pdélisdour u&eetoes qdueSéate eige smcnlect ivt derrririiqtlrs/p>

Wb) lx dpstesent.ires ,trr toeuicèr ent ,lce xpdupPSPpueiasiuienne.tsdaecugléent.dledgivenrnlent.,tpur lue#8217;Éil Deesue ne,tftua r pâmest rcnteien c.,la#8217;Himprtaate,dd da prepoot bllita thstriique Mue#8217;Éil Dvontdassume lesrlt ma mNteon . Atjurse#8217;Éhi éescahoixqst pcatir. Ou ben àn tectetftuoav r l&uDpioje daniqinteatutionnueed&uàlésident Mvisat ma mdissoltionned dfaceu duDPrvoir Législtrif, oulben àn tectetftuoav r l&esdprsscrit dela pCnteatutionndet dela ppésenrvtion dd pPrvoir législtrif. Tut lpstesent.irespueiase s e t ofit dcomplic léelceprioje dilaégalse rrnsq-dpmocraique preu ptre cinteidéré ar lun déect oen ,àar lsamctrcnteiripion ,lonsàdcpmrtsent.de la#8217;Ésnsmbre dd pPeuple aïtienndompm qun traîtredàma mPteiqm,pueiaau aàsacrofiédledPr esent.dpur lunmpla ueSa nsqle s /p>

Wc) auàleuple aïtienn,tpur lue#8217;ÉilupretnrScnteien c.eue#8217;ÉneeBgravedintac près (uirllessdvcqis qepmocraique eigu’Éill&ot idéienre daec ldéerreinteon pl coeoi sdu’Éillaclntqis qauàléi deedgrandsàsacrofic s /p>

WSuivet ma dsigntiue s /p>

WIteatutionn............. Nom,nPaénomà#82130;#82130;#82130;.. Signtiue #82130;#82130;#82130; sbr> strong class="spip">JInqtia ov,de qea Soiété tCveole/strong>& (ISC) sbr> Rosny Desiochrs/p>

Wstrong class="spip">JCnteeil Hïtien à&es Ate ursdNon-tatsque /strong>, (CONHANE)sbr> Edouard Paltere/p>

Wstrong class="spip">JRéseaufNtionalelescDéiensmde cDeoi sdHumnrns/strong>& (RNDDH) sbr> Pirre Espeétte,/s>

Wstrong class="spip">JPl trarma lessdOranisam steslDeoi sdHumnrns/strong>& (POHDH) sbr> Freud1Jan /p>

Wstrong class="spip">JCetre l#8338;cceénque de cDeoi sdHumnrns/strong>& (CEDH) sbr> SylvrerBnjeux/s>

Wstrong class="spip">JCnteeil Ntionalele#8217;ÉObenrvtion dÉect oenie/strong>& (CNO) sbr>Kensn dPolynie,/s>

Wstrong class="spip">JJsticc.ce lPaix/strong>& sbr> Jocelyn dCrlas/p>

Wstrong class="spip">JInqtia ov,de stCvoyenssPEggtgeslour u&e Changlent.le#8217;Haïti /strong>& (ICEC-HAITI) sbr> Jam stJvcqies sbr> RaouilPeck/p>

Wstrong class="spip">RLansmdaïti /strong>& sbr> Augsticn Jintud sbr> sbr> strong class="spip">JR vny1Janè /strong>, sbr> Marc-Kingtnn V,rgqn />

WPrt-au-Prince, Maoût20153 sbr> sbr> Ln rrsàivenrt d&lra#8217;ÉORGANISATION d pPEUPLEtftuLUTTE,detdrépn ,làluneamnvittion sbr> sbr>/p>

WPut-au-Prince, M& p13Maoût20153 sbr> sbr>/p>

LLs rrsàivenrt dànbsp;: sbr> Snn Exhele c.eMnteiersRMichl JrsnphdMARTELLY/strong>, sbr> Pisident Md qea épublique td#8217;Haïti s/>

LMoteiers

WL dCrmté Mexcuréif élra#8217;Éstrong class="spip">JOranisation dd pPeuple ftuLutte/strong>& (OPL) vuv,ésalusàau nomàd qea Pteiqmpcnmuna, M& gsdde2ou cAnctre Ss,ésaluttion ds#8217;Aéentdnt Mtglesint nau Cbllnet dela pPisidentc dui s mcru bon élra#8217;Éinarma tue t«nbsp;?Snn Exhele c.ele Pisident Md qea épublique ,eMnteiers

WMoteiers

WL dCrmté Mexcuréif élra#8217;ÉOPLpnstsau altcignorrrcu’Én crieelt mcuonaissatc d&sts pls rrsàivenrt , vuv,élee zlcertaoasint nvuv,éprssrqes xcue iqn s pertie.ts nbsp;;: sbr> sbr>/p>

L1) Pivrquoiàa#8217;ÉOPLpahoisit-eel td qboudrrclapre ontre nbsp;?< sbr> 2) Pivrquoiàdcied -t-eel td qm,lsineifen lsamdcieson dar lneeBls rrsàivenrt nbsp;?< sbr>/p>

WMoteiers

We dCrmté Mexcuréif vou dltarma ,dausca,soùlvo DcnteeileersMo#8217;avurntrn pas pprns tàlvus lescisr ,Mue da pomnjntciue (nstseRpetrepas p luncsimpl c«nbsp;?DqtlogumluirlesspÉect on nbsp;:»Meigu&e2a#8217;Éheue (es.lgrave /p>

WMoteiers

Wl qtemps arsse,st ra mcrédillitaéenécessiresdà tot DqtlogumlNtionalelsmbre ds#8217;Aévaporrrcd qjursdn qjurs. Enuu#8217;aauoes rerre s,àoiv,épeu,dpur lutlit=e u&a l tgesdueSShakepocar.,m«nbsp;?Timr1wile b poersnbsp;?» /p>

WL cfinsc-pstesr élra#8217;ÉOPLppou raitcvuv,éprsre eàmcroie lu&erl Pstico au altcahoisilonsàcamp,cftre ra#8217;ÉunuorSa#8217;iaure lé s prctagonosts dupchao CMoteiers

WMoteiers

Wa#8217;ÉOPLpnstsrppors ramaucue cdcmarche ui s biuie altc lunccoupue#8217;itatsdomnre la#8217;iIteatutionnlpstesent.ires,ue des xièm llutdqcd qjanvier 0154,Ptele duiela pperpétution dd pdérègllent.le pcal.tdrier éect oenldpraiqueé lar ll#8217;iéui pe iuprrvoir lela iss ppéseagns /p>

WMoteiers

Wl qcamp élra#8217;ÉOPLpvptutjurssdté ,drestsde sdlenue ramheli pd ,snnsttutionns,Pe slnore s,àe slval.ur ge.lessdpiitcip sdrpubliqcaoas.2C#8217;est pl qcamp élrcsle sce du Nce xpueiaseubattnt epru u&a récupéraéon dee nnre ldignié ,dour u&e r touvr ent ueSnnre lsovenranesé .2C#8217;est pl qcamp élrcsle sce du Nce xpueialu tet epru u’iavènlent.le#8217;Hue c=oiété tmodrna leminié lar l&a rasons,Sa p=ien c.,lae réogrès,ra#8217;Ééducteon pn laa iechnoiogce.2C#8217;est pl qcamp élrcsle sce du Nce xpueiacroint Mue d’iavntirc&uàlys, pss= lar l&a Refntdaiqn td qe#8217;itats-Naéon ,le#8217;altstau aion d’Éunctatsd&epueoi àepmocraique ,ra mcréaion Pu#8217;aue c=oiété td#8217;Annceu in dprre tat ta#8217;Élteégraéon dee a ppys,anneiqmpueiaempisentee 72%dee a pppulatiqn tet dela pdiasprtatueiaeéunit 87%dde2ou crsseru ceslhumnrnes.2C#8217;est pl qcamp élrcsle sce du Nce xpueiareaerl a nt àca#8217;Éémrsg nc lé#8217;aélit,,douitiquess,eéonomiquess,louiétlrs,dlterlect ella , sporsov,,,siticstquesspt rolteue

WMoteiers

WDeuis qvnre lucueqsonsràla ppésedentc desSaa épublique td#8217;Haïti ,a& p14gmaic0151,nla vi douitiquesd&uàlys, st prythmé lar ld slscandtle dftuca,cadm.dL qpiocessusdueSnorelesation snnsttutionnueel tn#8217;est pas pnt.im djusu’Éicipn lasgvidernnsttutionnuee,CMoteiers

LCsrtaoassdueSvo Ddpiamraéon saomnre la#8217;iopposaiqn la iss t ta#8217;ÉOPLpperplex .WsoasRqua nnn/s> epru u&a rélesation sduDiqraca rsruhit écueiacpmrgn rit lauprys, c qboua ve ssent.dpuitiquesdueiaouv,sengliuie aSeut le éeut sp>

LMoteiers

WL dRappors u#8217;aenquêt dela pCnmmiqsonsrséateiiqtlrluirle#8217;Éstrong class="spip">JAffair d&udjugedJan Srsg lJrsnph/strong>&,àa iss pestetde lu&erl Cheftd qe#8217;itats,RledPiemcrrcminstre aeige pminstre adela pJsticc.cserntrn ptus le sdrstjue s L dCrmté Mexcuréif élra#8217;ÉOPLpsticm Mue#8217;Éills#8217;Éage -làlé#8217;ane cucussaion graveduei,psige pRappors st prporouvélar ll#8217;iAssmbreé rd slséateers ,trrovoua ramunstrert dtotal ddslorédillitaé,lcar ll st pnnconcsvtle lu&erl Dreu Chat s Dït oroé sc&uàlys, puiss t tmntiorueff nt éent.dàma mNteon . Jritss Dïtdrefus e sles xcbéttehs dupPrvoir excuréif é#8217;avcheminesJCTCEP/strong>&rtupPr esent. M& pconceu in dupRappors u#8217;aenquêt dueSéate on peorséra#8217;ÉOPLpàDdpiain,r1ce tepmnvittion sp>

LMoteiers

WEncvuv,éfaisat msaoir eu&erl temps arsse,,ra#8217;ÉOPLpveu ptot simpl int nateien lvnre lutention (uirlessoai lu&erl ays,ssscenuetMeigu’Éo dst éàlla vniel td#8217;Éunctsunaiqdpuitiques. Il st pnnconcsvtle ,CMoteiersJPirre Suley/strong>&,astrong class="spip">JChr eseanel Péenlte/strong>& e cstrong class="spip">JBennît Bareaeiel /strong>&,afine aSeôé oultardlar ld eandes desccnmpss Dà(s dirigettt sp>

LMoteiers

WL#8217;ÉOPLpsai lu’Éillexist,cd sldirigettt douitiquessiui son pahoisileelpactq=e uaec ll#8217;Aéernsgsrdf HvesdueSrrovoua r1ne aocusption Pisr tesd&uàlys,,lce, dns lescbu lévdent Md#8217;avs=ue rSunccotreôlrdtotalluirle#8217;Ésxploittion dueSs smrsseru ceslminsèe s Cs,édirigettt don pdciedéeeelfema tae eye xcsirle#8217;Éitreodut on àdupcholéenRs Haïti ui s moai lreu Cde hui celliepmrt stau s i dee a pppulatiqn . Yal ,ra marsstigieus tunierseiaé nm rccaoae,pri n du Ncntfirinr Marès lueSnoires xlcheech.ur gnord-im rccaoasdftMeuonpéens,Pu&erl Dtrurp sconu inne. csit drepoot bllms dela ppéopaga on àdupcholéenRdns lnnre llys,. Mclgr Mrust,ra Dït oroé scaïtienne. ccotritu n du Nfair da p=ovrdeuirniel . Ele scnstr toonaissrn pas pa xcfaelliesde slvicicm sàdupcholéenRleceeoi àà1ne arépmraéon dusti aeigéui tble tee a ppyr Md qe#8217;ÉONU.JJvcqies Stéphen Alexos/strong>&, dns lLssaarre sdmu iien s,eéorltcae tepphrassceémrtble nbsp;;:C«nbsp;?Lssaleuple csit dompm qlssaarre s, il Dfl.urissrn pauàléintempsnbsp;:». L dCrmté Mexcuréif élra#8217;ÉOPLpepoèr ,pMoteiersJJvcqies Solnie/strong>& vuv,élid ramà onmpretde loivrquoiàa Psticos#8217;aobstoasRtat tàevccompanees

LPivr erreiner uirlne aooteppusaiqv ,pMoteiers

WL cCrmté Mexcuréif élra#8217;ÉOPLpvou drennPaesd Dït oroé sc&uàlys, puisnt s;itats-Naéon ,lpeiqmoquesspt rouv,ésauhit éd&uàlursrgeglcar lou dn civn auus lebeso dpowurassume le Doéhlckc&uàlyssséf l&uDtesentele rrnf nt é lvni oeneus tmt le smcmomt s dirficialsiui so#8217;avsnoce dntsp>

LPivr ee Crmté Mexcuréif élra#8217;ÉOPLp/p>

WLtrong class="spip">RStvenrr eirre SÉIENNE strong>&/pr> 2Cotdionaisurdeénéenl,sbr> sbr> Lbr>/p> />

WPrt-au-Prince, Ma10août20153,p> É Vseiao officiale d&uàBrppors uinles&ema mNcmmiqsonsrsépéitlre.#8217;aenquêt dueSéate oirle p=rt dsuboctuéd&udjugedJan Srsg lJrsnph/st3>

WLAès luoir euaurtqn sndd rNtéirns -cl,se lrae ursdNelceprdssilertrivebln Mue in#8217;estnfine pas pa Nfair da slvalgss,lo ,snnsestqgtioursdalcoe andessda ppmi pestucussaion gupPrsident Mdtrong class="spip">JMichl Mcrtuley/strong>&n,gupPrsmcrrcminstre aetrong class="spip">RLaurnt Lamothe/strong>&gh l&uDtinstre adela pJsticc.castrong class="spip">JCan RmueesSanon/strong> Pueiaearntrn ptoupule sseelprtjue s,a ppmi peà pedlf-suii do#8217;Éunctvntiouesae ocès-d pdéense&uDtuibuele creol eelprt-au-Prince, Matrong class="spip">SRafyitdeJan -ichl strong> Pueiaeu altcaglesint nantiore.lessdpirssdut,,déjiacoires aomnre laMetrong class="spip">SoOGrydéLisadeustrong> Pucussaeeelréecelsbr> Pblicédee1vntdredta29août20153 sbr> sb href="eRppors uinles&ema mNcmmiqsonsrsépéitlre.#8217;aenquêt dueSéate oby kiskeydminsclass="spip"_out">dRppors uinles&ema mNcmmiqsonsrsépéitlre.#8217;aenquêt dueSéate oby kiskeydmins/a> sbr> sbrong class="spip">JInqeodut on àdtpMri pestuntrepxe/strong>& sbr> sbrong class="spip">JIssalit unbsp;: & sbr> sa) Q s movnbsp;: ? Q s mostetdeubsp;?< sbr> 2b) Q s moai lu&eoibsp;: ? Q s #8217;avuas paai lu&eoibsp;: ?sbr> sbrong class="spip">JIAleyimde cDe sndemcnlect ié Dà(sr tocru#8217;aauortqn sgme tréirns n lu#8217;avccoursdstrong>& sbr> sbrong class="spip">JII é lesetion dd,,déai ldstrong>& sbr> sbrong class="spip">JICnceu in strong>& sbr> sbrong class="spip">JIRcoe andeaéon ,strong>&rtu) D8217;iorae deénéenl, b) D8217;iorae deépéitfuessp>

Wstrong class="spip">JInqeodut on àstrong>&/p>

WSLSsavmdta143 Juleer20153,l rseles da20 eue (,st s oirlntu à1a#8217;iohôpéblsstrong class="spip">JBenrnrdlaMev/strong>,b&ss lea Rnmuna, me tDelmasue desécès&udjugedJtrong class="spip">JJan Srsg lJrsnph/strong>&,àsmagtrea onndohlrg,ue pdéesilertlra#8217;ÉOnquêt dirle#8217;Éiéps errige pmfistdupPésident Md qea épublique t,tus le sxcïtussaedNelceorupiqn t,u Ncntfcussn t,u Ncdéor lnent ueSnbn s réliqcR n lu#8217;avsurpriqn td q ntcionnu Enuueffe,RledPugedJyvpté tsansprarséraa ue désauism&sts pvaellies rseles da3 eue (,e pmie loursdnns luneéatssPugeraa ue désepoot bllms deuc t ne heospéblslertlran domnpéétt.d,c dui spiv,é-stetdeens lescajrg, méodialaupeéatssPnmuiourx,upeéatssP#8217;Annceteien c.e. Pssséf mayhasdueSaanigeglc aysint.dàpté tsdmindpa ue dCdocersRSLidea Théodorustrong> Puug nctst,cdtdréotion dd.cser e-làPueiaeuimpéodiatint nrmeis qa désarvic dse pdéecersSoOBtihu Gree/strong> Punmpiojfse,, l&ele#8217;alUierseiaé nd Miiiqdpei,psns lescadre de#usr toenrdi onnist,n Mutre ra#ec t ne heospéblslertenrnrdlaMev/eige pcht ne hnierseiaéir daflenednn,tps=ue i laa iéotion dd.cser e-là L dCmaldeuàpté tsrs lendohlrg,ust xela,é eige smsauism&&ersmeisé i lansàcamles son paé tsrsodigu,,steeonle ,snnsacitsn dupRéesilertéodialau#usr int.dàan Srsg lJrsnph//p>

WL cCdiagnoicc.fauquesa smcmé iesncsit dor tntu sàcl pRdut,,d#8217;Éunctst prpuscandes<àélesat(uirlelacustais ei é lesetéar lneegrurp ueelpmé iesncseaerl a n Mutr synrgqnt,tun Mutr ïti ui 8217;estnfFlened Maràélvéléne aohmrtbrgeistaisiv lou nov lau&ele#8217;alhmriphèe (eeoi àepuc tr lau,c dui sparrovoua éne aohmripégisdeéahe RSAille Henr/strong>&n,gnuonpchirugqntnrnf icéde1a#8217;iohôpéblssenrnrdlaMev/ L dCmé iesn adciedéeee8217;iopprrrcdmpéodiatint nrirle p=basdueSal8217;ÉOmbgegqmpeeialu iàpté tsnmuna,ueé l,tais eaat dll st pnerivede1a#8217;iohôpéblss rr gvuc aysint.dàfael lufce,dletsnmuna,ueé aec ll#smcmé iesncsi so#8217;aveeéatsrn ptolrg,ésvait na i,psllaclnangleee8217;iovisRgeperéféré stentdu lu&ersneonle apraiqueéra#ec tgesnmlgs Dïtit nae8217;iopprrrclcar l p=ovrd,oeucrsaielent.le#8217;avuva pas paputre cment Mfiéd /p>

LLssaysint.dàpté tsaitsetu àiv,époenrvtion dÉusu’Éiàc dui ee dCdocers

LCsresécès&ur u&e rirns nuboctuéacsnga veéne vrcrele teéirnou nov lau&eleot s naivneon ,duecaertaoasésare ursdNt dompéodiatint nrm lendohusscP prepoot bllita theSal8217;ÉOdminstrea onnepcrtuley/-amothesrns les8217;Ésxplocitsn Nelceprdécès.LssaarumursdNelcut leuti edNt do iss éestetde lus8217;Ésxpst,tc du#8217;ane cuertaoasiréunin tdllaiqlla tedPugedJu altcag tsnmnoua énetdllaiqlla turntrn pas toeuipéeige pcésident Md qea épublique t,tige pcrsmcrrcminstre a,eige pminstre adela pJsticc.cbsp;:;Ccepertdat tqaiqlla tesdprsscin dnsau Dït ntrn paé Mexcecém d,e.lessdpntac pDdpilacué Dït ntrn paé Meiojféées, Cs tepreunin td e t olàe p=basdueSstriveblsiui sot ntrn pamnduirptoleztedPugedJasnph/vSuncctusent Mviasculir dacré bnl,s Livneon ,àpté tsoua ve ssérrigela te8217;est patcoe . UD dfxqslcitsn dit doxqgnéete.lessdhnquêt drpuassméeteun Mur ld slstoyenssPsi8217;Ésxplrmbg Mutr eurdmomàdéopa aeigeu nomàd qear lvteachlent lnàa pdpmocraiq ru&ercr ld slsranisation dd qea =oiété toveol ,seRpesaiqn ,nn Pa xnomàd qear lviqsonsrs Ncdéensmde cDeoi sduige berté, dela ppérson na,eigeaussneun Mur ldlsdrstjtsRgeperanisation dduitiquessius8217;Anncsug nt mcuonne hnieprssillelentac pràe#8217;Éitrépntdatc deesa pJsticc.casca#8217;Éémeilibe (eesmouroir s,réliqcR ,eigeaussneuonne hnieprssilleletenttseta xcïtqis qepmocraique ,st enci denmpivsilleleééi lheSal8217;ÉOétsd&epueoi àetr ïti /p>

LLssaéate osSaa épublique tda tentdullroisi urssdprr u&ir euige pJsticc.cserd e t olbisirdesSa#8217;iavfair ddL qcateate oaya paé Menégrif, oaàlursrsu#8217;ane cueonérnt deesmousident MdNelceomiqsonsrssca#8217;Ééexea tdinaii a,eigeirle p=eeande EupPésident Md qea écmmiqsonsrssticc.ce lPcurssaéddblique td l&uDtesenent Md qea écmmiqsonsrseoi sdHumnrns/d l&Asq-dCorupiqn tdupPéate,tfe arépoltionnedpté tsdmoptédà &a rsétc dee/ tsmbreé rdpégsèe sui sparsuii a pomnjérnt deesmousident Md. Assidtftudéa dueS17 Juleer20153,l e cueomiqsonsrsépéitlre.#8217;aenquêt dpté tsrmau rd slséateers ,bsp;;: sbr> sbr> />-JPirre Sancçcky EXIUSstrong>&n,gesenent Md qea éCmmiqsonsrssticc.ce lPcurssaéddblique tbsp;:;Csbr> sbr> />-JPWt pes<àPOLYCARPEstrong>&n,gesenent Md qea éCmmiqsonsrsSa pé Plique td l&Pulatiqn .bsp;:;Csbr> sbr> />-JPancços /&Asick JOSEPHstrong>&n,gesenent Md qea éCmmiqsonsrsIntéi r l& l&Clect ivt deTrririiqtlrs/bsp;:;Csbr> sbr> />-JPt vnt I.tntunncbBENOITstrong>&n,gesmcrrcmaresetir d&udjBe (aubsp;:;Csbr> sbr> />-JBJoë JrsnphdMJOHNstrong>&n,gu xièm llaresetir d&udjBe (au sbr> sbr> cs tepreomiqsonsrsépéitlre.#8217;aenquêt dptrr u&iqsonsrs Ncair da loursdnirlesspÉtrcnteilnc smeaya pat Mrsdée p=rt dsudjugedJan Srsg lJrOSEPH Ele s bénéfcoirele#8217;Hue c=ééi odede hui ce(8) urssdpuvr llms dursdnsquêt rgeperéouiredànncbrppors Aupsidtfdèlea Rf dee a ppsétc d,a mNcmmiqsonsrsé8217;est p-la tmi peauseaerl a, élsat mstr s td e denmpisenent Md(ancços /&Asick JOSEPH)gepeucbrppors r l&(Wt pes<àPOLYCARPE)s LivéthuessueSaanerl adpté tsmpéodiatint nrdmoptédàepeucbagtdat bâi Unlceorupoot atc depté tsdmssci laauCesenent Md eSéate oi pd ,andea Md#8217;avse qsed desccnmrupoot atc dsscaertaoasésignié res dela 8217;itatsdoaf dee#8217;Éil Dvslretdet Md sposnilms dursdne ontre ral#smcmbre ,sd qea écmmiqsonsr.Lssaaanerlxd&ema mNcmmiqsonsrsn pdciboépidèleaSa nsdmaitDtec ldéslséatc dss#8217;aauortqn sme tréirns n lu#ecnlect iededdrlsndemcrccent lres /p>

LLbrong class="spip">JIssalit unstrong>&/p>

WS1.-Tut lpmNcmmiee tà loueuta146 Aût201532,eaat dlMt u aetrong class="spip">RLNewnn VLos qeSitsesstic/strong>&ghasdmssci neeBls rrsàiupPr ee tteelprt-au-Prince, our ld éoce d desccccoudu&erl P éoce iisurdeitlrfen Nelceorupiqn tdL qc éoce iisurdentdai lansàccussaion girlessoai lu&erl 8217;Éiéps erruDtesenent Md(Madmeletrong class="spip">JPtophiaeSitsesRemyMcrtuley/strong>&n)etqsnncbfistd(trong class="spip">JOrlivrrcMndtuley/strong>&n)eesenensrn ptolrundee cueomiqsonsrsesenent Mile cueiaoispostrele#dgrandsàsntdsc&isusdueSlcarssrnc&uàTisiordobliqcR Cs mNaohusséne ertaoaseéirnons llrsdfmdtaasd qea écapéblsecar lc8217;ÉOéts laa iesmcre suoi ip’Éuncltoyenss strele#8217;avsntiourr uirlncdésarnoes qdn dotcoe laxploié idr ldlsdrbâi e,, ls rsetuexd&ema mNpmocraiq /p>

LL2.-Ts mN, me va pas pa#8217;avsetrer(slàPucaLL3.-TQuelessiuurssdpru Cdardlloui le teavmdta14 taeptmbre 201532,MnteiersRMrsnphdMGuysr éC UD lvastrong>&,àsaresetir d&u8217;itatsdota pcnmunaacitsn Naaputre cmstetdeunirlesspÉtdetCde hRadio Q ssessya,gesecsat msec ldnclbrn éelceprtuted,Mue da 8217;avsegt nuielaépntdstrn pli8217;Éiéps erruDtesenent MdsSaa épublique tdMadmeletophiaeSitsesRemyMcrtuley/etqsnncbfistdrlivrrcMndtuley/rrovotairtdeddrlsc&uàTare ursrisvaé/p>

LL4.-TLivaellies esenent Mile cuallt dcomne c-teauessreaat dllllutdqcd3aeptmbre 201532,Ma ue dCbiai dursnncbtocaéolMt u aetrong class="spip">RLReynid Geoegt/strong>&, eie cuanoceçt olbi volt éeP#8217;Anncntior1ne aoa on àdtndirfiaméon domnre laMt u aeNewnn VSitsesstic/ O#8217;ÉOtocaéolagesecsaép’Éu xcfrre s,esSa#8217;iavtoeu cu196dupCntelceeol eïtienn,tp Doéps xserd ppors t msmuella nt. M& tesenent Mduva paeceeoi ààelprtsed desccsseru ceslmàun déaps er/p>

LL5.-TLSa nsdmaitDloui le temrdli 4aeptmbre 201532,Mnt u aeSitsesstic/aeri n duta pcnlrg,uee/ td qsbt /ne aootaesd Dceorupoot atc depàlurpmisiresdàuàTivenrnlent., ur ls.uggérrcu’Énl eyduva paeiu ds8217;esuvr i1ne aonquêt djiacoires rirle p=basdueSDdpiamraéon saodlaMt u aeGeoegt/Puca

LL6.-TL8217;Av fair d&e va pas rl pRdut,,dretde lcntrpqauàléitssee8217;iovioi1ne aonpst,tc duéopa aeàeie c-me l.TLivaellies esenent Mile csteeonlets lescsnnsaciesd sposnilms dt dpmcvenrt ,daofm lendoéttelSeut ll ,sdgrninsonip’Éuie cuavt olàesadispostuonnetursdnspsayeru#8217;aaéor ff ta#8217;Av fair d&oàlie lo qea Snensr Atjssneesdprsscin derl t n-el tDdé Mexcecém dgirlessourpmisiresdàuàTivenrnlent., slort-au-Prince, oMt u aetrong class="spip">RLan RmueesSantrou/strong>,b&ur lue#8217;Éilupreocdetfàa#8217;iavtepation erdlaMt u aeSitsesstic/dour u&inue s n viselesppésedentc det dprfiaméon d.aMt u aeSntrou/ #8217;avuas paputsedesor1nx dpiiscin deiaeeeonles epaopa arerre s,on paé tsxcecém dgirles spe ue dCinstre adela pJsticc.caMt u aean RmueesSanon/ Il vmNpmoqsonsrndd snnepnoic/a dC26aeptmbre 201532/p>

LL7.-TLSa11 Octoe 201532,M dCinstre adela pJsticc.caapépn uàTluneamnvittion &ema mNcmmiqsonsrsjticc.ce lPsurssaéddblique td eSéate Il vm oaàlursrsu#dce tepreunin t, niéeut ll ,sdaaégalsn dupRurpmisiresdàuàTivenrnlent.,/p>

LL8.-TL8217;Av fair d& Sntfnuutre remps ae cuertaoasircusalmieÉusu&#s rseles iroisièm lvsmaitDadelaanvier loui le te22 Jnvier 01543eaat dlncltoyenss épn un Pa xnomàd qetrong class="spip">RLEnid Flenpati/strong>& vai lue aocttion &aàlurr teon PeesSur luturpriqn td q ntcionnu Es tepra on àdvi pe#8217;Éiéps errige pmfistdupPésident M,repoctuéivent., MadmeletophiaeSitsesRemyMcrtuley/etqsrlivrrcMndtuley/ MoteiersScAde é ichl strong> e cstrong class="spip">JBNewnn VLos qeSitsesstic/strong>&ghnmpmlptocaéo /p>

LL9.-TLSa19Mndts0153,l #8217;Av fair d&aueffeuéivent., cmarcréaupryslai dursjticc.ceslort-au-Prince, oaat dlllluibuele ct pafficiale dnt nriisirdL qcugedJtrong class="spip">JJan Srsg lJrsnph/strong>&, t patcohlrg,ue Sa#8217;iavfair ddt dpmcidadela pJrersre eàmc pJui citDa/p>

LL10.-TAc pJui citDara Dïtocaéo Michl J lPcitsesstic/astseRpetentee pas pdL qcugedJai lue aose ansi .u#8217;avuortec depàl14fMt 0153. Lssaarocaéo MstseRpetentee pautjurssdprasl #8217;Av fair d&t pryersre laauC21fMt 0153. LAce teprd e,dsedPugedJasnph/varrovoce tàunPugedmt Mduva n-di (eeoi àeyersret ta#8217;Él fair d&aua11 JutDlouuii a#8217;Éuncture léyersre&aua18 JutD0153. p>

LL11.-TLSamrdli 18 JutD0153.l #8217;Av fair d&t prstetdeul,tais e pplèaidoi1itseRpéréou Dït or l&esdoic dse e rma lentrepu sàns lescajgedmt MdudjugedJasnph//TL8217;Av fair d&t pneor,guàootaestdrefrsre laauCmrdli 02 Juleer20153, p>

LL12.-Ts Cmrdli-làPu#8217;Av fair d&t pràootaestdrstetdeulcr ld svt taeprugedJan Srsg lJrsnph/ LAce teprousasn ,ra Dorocaéo MNewnn VLos qeSitsesstic/d l&Ase é ichl plèaidtele rreeande Pa xntnbuele cdpcctterhnmpmlpréirns n onmprart u aeesdorandsàsurpmisdela 8217;itatsdotestdes esmcrrcminstre a,e dCinstre adelsfinrni ,eigcdL qctnbuele cetdeàunPugedmt Mduva n-di (eeoi àens lescquesalls#ollic éd&uàlurpmisiresdàuàTivenrnlent., e#8217;Éilupobenne.apuDtesenent MdsSaa épublique td#8217;iauretéséaonnetursdncsdorandsàsurpmisdela 8217;itatsdoelceomrart u aer ld svt taepruibuele crrr teon PeesS xcfrre s,esSa#8217;iavtoeu cu400dupCntelc#8217;Annctrut on ààcriinerl /p>

Wd13.-Tcs qnl8217;ÉOtocaéoldqea faelaies esenent Mile cu#8217;estnarssrnruas passourup Il vi é lj teprareesadèleaSa08 Juleer20153, L qcatpmisiresdàuàTivenrnlent., firtdeddme l.TLRteextue Sa#8217;iavreesae ecsaMue#8217;Éil Dvn pdceandeéota pcnmuru#8217;aaureesadlort-au-Prince, od/aeritirc&irlncdPugedmt Mdru uu6;trtsgeigeg1itfsohusséDorea faelaies esenent Mile cur lde teprdieson d8217;aa/p>

Wd14.-TLSamrdli 09 Juleer20153,l dCdonse&uDtuibuele cdpcrsmcrèrqnnstlnc teslort-au-Prince, ,lMt u aetrong class="spip">RLRfyitdeJan ichl strong> ,dretdetedPugedJan Srsg lJrsnph/vds lsnnepvéheuicdueSsarvic dn lseucetdeàec ldnnepns=bgegr (eeonle ,Cdonse&s s-me l)ïtdreftau ai MdTle tee aCajtiau Cbhmp élrandts0ur ld iscutrcu&#inzd&oàlvngtnCinsus dupra Md#8217;ave aue iqn dimpl i Seuonle ,CdonsedsedPugedJvoult dceulldnt nriiir euige prrvoir ,excuréif éxcecçirtdeddprsscin dmnre la#ui sbr> scs qneeonle ,sn ecstmcntfli idr ldlsPugedJàpru CiursdNelcs epamsRgepeuonaissatc d/Puc8217;est palutô Mu ,Cdonse&eialu8217;avuaamnéeJàpe ontre ral#8217;ÉOtocaéoldqea faelaies esenent Mile cuusca,lnet delaMîtredàGrydéLisadeu/p>

Wd15.-TRtre dd sWashngtnn Veneot s nug nc l,rvpreeeéeeeonles epdes pu ldlsPivenrnlent.,tpmteiersRMLénlehr ese/strong>,b&e ontre domteiers

Wd16.-TLSaugedJan Srsg lJrsnph/vntfliemàun déiqdplqcugedJtrong class="spip">JJMtés/strong> u’Éillaclé tsmvit tàa ue dCdonse&àpe ontre raldrlts luat s Dïérson nalé sc&uàlivenrnlent., a or l&esu#8217;Av fair d&tre rrs llontre dta faelaies esenent Mile cstteslsdilafuva paepcnlrg,udL qcugedJMtés/vi pdnteeileer&esuneas pa#8217;avy etde l. Pu Cdardllollrnti n duor d&auaugedJMtés/v’Éillex Naap esémàun déiqdp rcnteiileeraamrîu aetrong class="spip">RLSamu Mcrdstqu/strong> u&#alu iàptd lu’Éilleuroitrta#8217;avy etde ltais eaa8217;Éille#8217;avuva paucue cdoncsvsonsràlaair ddL qcugedJMtés/vhaussep Doépaums dt d.apu lreu Cdi r sp>

LM17.-TOdst éà loueuta141 Juleer20153,l désarvic dse dCmétéoriogce.derl t naunoce tàncltycloned la#8217;Éimlrt dtéougcuavt olé td#iamraéda loursdne ecént M/Lssaaanerlxd&emslursrsu#8217;anisivs epds lea Rrégi méotopaoliaoasircvtrn paé Memomt sanént nrirsrtdau, Cs oueutal désoclxxpdupPyslai dursjticc.ceslort-au-Prince, ocvtrn paé Meraiqueérnt nvuidés Mcs qnedPugedJan Srsg lJrsnph/vei,psxxpdues delas epair sre cvra,,dretu&#s jaais eunoursdnnSaanerl adéts lantu àirlelacus.éCmmieilafuva pasmc ee éeaa8217;Éille#8217;avyduva paretu&#s s pa 8217;avccovt d,ll st pn rer lnétolezte iààCblla re.V,rgs 12h30,ll st pnstuntrrselion &aàltéléphonedec ldnnepéps erraat dlllldonse&eial#8217;avuetrea pas pa Sa#8217;iavreesr1nx ltéléphonedereee cuàootaestd Il vetdoi ndnnepéps errursdnepn urlaauCdonse&eialuiaoist (eeonle ,rNtéirngngegpconceordtt dottesSa#8217;iaéps erruDtugedJ l&uDtdonse)uoir eubeso dpdla#ui TLSaugedJasnph/vdeande Ei ee dCdonse&s svccomdeuie aohue (eru u&e#8217;Éillsl/aerjrngns.éArivedeupryslai dursjticc.cdsedPugedJasnph/vgaedànncbvéheuicdues llrsdfrartgec&uàlysee tte rcnteitu nsca#ogsrdfà pedlf pcnmuru#pryslai drseles àirddursdne jrnde lus,Cdonse&eialu8217;avutetdeenéjàvds lsnnepéopa aevéheuicduse&arche TLSaugedJéts laccompane bcursnncbtnt.lessPsurssaédla#8217;iopficialdnnSaaolicdJtrong class="spip">JJaohnnyeirre strong>&gh l&ursnncbnmusnte.lentflint Mdtrong class="spip">JMBeese lsrsnph/strong>&, eu Cdntfnuuss lescisobrie tteelpTi SossaédL qc onse&nctrutitaeprugedJell p =e ual(s dccompane ioursdaca

Wd18.-T,rgs 19h,asgviéheuicdueuCdonse&nti n duec ll#smcmê s,onusptinunbsp;:

Wd19.-TRtre ddolezte i,esgvugedJereee cunnepéps errcmmieilaflllutiduva paremcsdnavt tanncbdéyr Mdru u&a rélnin t TLSaugedJasnph/vxqslce tdaor,guàonnepéps erraa8217;Éille#treu prutidair d&nccomprtucetdeudela pJrunin tdr lltéléphonedar ll sadéslsérsrciaosm&&ersnneptéléphoned s ois lemcvet. Il sremcetuàonnepéps erre8217;ÉOteeraaempruior1ne ture léereanielme tréléphonedef dpdla#uivract é lvdpmfisex Naiguleera pJreontre /p>

WM20.-TLSantdredta212 Juleer20153,l dCuged,rcmmieiàonnephrlnted,seucetdeàepryslai dursjticc.c Il vettrn ptus lee xpueiarrtsed sde vt tanncbbe (au&ur u&e sdnsqslce tlvsppméssntiourr&uàTar e#8217;itavt t Il sroussepds lsnnepbe (au&lqcugedJMtés/ve oi pdract é c dui spi8217;est palsssé,vvpaau&be (au&udjugedJtrong class="spip">JJSitsesVi strong> e csi pdract é c#8217;Aéhstqoes,ue deugedJtrong class="spip">JJSrprs lstrong>&, eénèe ades llrsdfbe (aux&udjugedJSitsesVi ,ll si pdract é caussne p=re lohstqoes, Mcs qnedPugedJSrprs ldes esmdeà(sr toc(eru u&i8217;esêe léye uàTluneamrunin tdinopors uned laru u&neas pa civn iuaec icos#8217;itavt clcs epamsRgugeds Il sretdeens lennepbe (au&madmeletrong class="spip">JPKetly Jueiu/strong> usSa#8217;iaranisation ddIMEDe csi pdract é c#8217;Aéhstqoes,ueRLSamu Mcrdstqu/strong> uauquesalafuva pap esémru Cdaôpa qea ée iqn deri n dutannepbe (au& lasgvugedJasnph/ni pdxqslce tdcmmieeta pJrunin tdi8217;est paéréou d /p>

LL21.-Ts Cme lontdredta212 Juleer20153,l madmeleKetly Jueiu/usSa#8217;iaIMEDe#8217;Aévta pasmdeulcau&be (au&udjdonse&an ichl eccompane bueelpmadmeletrong class="spip">JPvcqiesin,rehr ese/strong>,b& cstclass="spip">WsiiiqdpHeralds> e Es tepresontd&e va pasre teneiàomadmelehr ese/ e8217;iovioi1ne aonre esduec ll#sjdonse&ef dpdlaetde lcntprtuc s prctblèmnc&uàTisbuele cdpcrsmcrèrqnIstlnc tàe slvugedsc#8217;Annctrut on à,sttesSa#8217;iavcompanelent.le Sa#8217;iaIMEDe xntnbuele SeuonlemadmeleJueiu/,de teprnre esdu#8217;avuadsdée&#s rngtnCinsus Seuonle ,Cdonsedsla turntadsdée sxcïeue (,

LL22.-TLSadonse’avuas papreeeéeedPugedJ.cser e-là L dCugedJe8217;est paye uàTlu#8217;iaEsèr ,puisn’Éillacva pasmdeez-uv,élic ldnnepéps errursdneamnéerhnle c-ipnàort-au-Prince, oedPie losor. O#8217;est pl 8217;iaéps erreiarretdete8217;Anncuonaovecftrreeande &auaugedJnnepéps xpdla#uivract é lv dui spi8217;eséea pas pséà &a rélnin tdudjueuta Il sai lue n ecstdxqhausif éàonnepéps erreqea éetd, l&ele#areunin t, Sa#8217;iaent Mitédesccs toeuiptt dottesSa#ursrisverreqeostuonne/p>

LL23.-T,rdredta2sr ,la#SaugedJasnph/vx paye e dd s#8217;iaEsèr ,peamnét msec ldl spivepéps errRahl e(eiaoi va paepn urlaSunccsmdeez-uv,éloleztndeqerm oooguml),s pvaleer&esu11 s leJvsoncaPuboss Fito (nmpilombircu&#idéts laèsicosec ldl splu#8217;iaEsèr ,p xcfaism&s8217;esévau ta#gpconûtsu#8217;ane aanerl adààélesater),stteBeese lsrsnph/snncbtngdeéarrtec Cs s r e-làPuot sibreét dcoalmcftrri r d.apusirlpostrele&#ict q nscaporoéhedes d 8217;iaévésint nafati/ii spallt dcirlntu eu&erlessiueue (,eru Cdardl/p>

LL24.-T,rgs sseelxcïeue (,e teavmdta143 Juleer20153,l Rahl ex patrées&ursnncbse aeluprsue dCbutitae Ei eli eechoerreiartomb Ele s regadeuids lea Rsr tesn tdudjbutita rouv lansàcmariJan Srsg lJrsnph/vspsayeru#,peamtsed de n ecsp n duos lescquesallspss i l L dC ecsp n dutomb ue aostoonds oi i TAor,guRahl evo cuuscstoorsdNelcan Srsg lJenrretdt mste c-me lsl/aeecsp n du lasgvttirc&ursdn’Éilleu =e LAce emomt s,can Srsg lJe dbhe u laRahl elevettrn ptursnncbbracDeoi s Ele s i pdaosene aue iqn dllaiqlla tlle#treroitrtaépn url Il s#8217;avuva paru Cd 8217;iaubgegodts pvltgesd.aRahl eereee cuBeese lseiaoi sctdeens lespcnlrre 20oùàn triveetrn plisourupled la#8217;Éienft t IBeese lsreçi le 8217;iarae de#8217;Éuteeraaheech.ul&esu#8217;Av ie &auès lueupéopa iéair d&ema mNais n/ Il vnti n duec lle arépmteiienégrifvd.aRahl ei pdtsem Mu 8217;iarae de#loeftaeuaec llan Srsg lJrtdat tqqu8217;Éuie cuèsicarptolech.ul&lepéopa iéair d Ele s i triveetcaussnaôpauti iuids lea Rr t,tige pseelxcïit doaaégsaheech.ul&esu#8217;Av ie &auès lueedduitices qdct tsrndsepàlurpmisirdi one aCala re.VLedduitices qdvnne.a duec llRahl ext&lepéopa iéair dext&l Dvbre ee tntcaussnaôpaan Srsg lJns lescavéheuicdueSslapirlicdJqial#8217;avuva par pap=e z&urscarb ai Mdur u&e raneje,Rlepaan Srsg lJclé tsi sctdeu&udjvéheuicdueSslapirlicdJur u&êe léyé-bre ee évds lsnnepvéheuicdueSsarvic d Il st pvmnduirpt1a#8217;iohôpéblssenrnrdlaMev/0oùàllaclé tsrs lendohlrg,u/p>

LL25.-TLSaai le teru CdbutMue insseru Md qets lescsn ecstmcepai eets lescsnréirns nt dreppors éPuc8217;est pai ee dCugedJasnph/vavt olé tdesonb int nria,ueé eigu’Éol svta paxxpdues delaertaoasésau&braetursnnre 2dnns lune Ei elct q nsdérsscin .pIadéts lavgeléftrreeandet dcomniilet1aut sMcs qnllacva paa, meecsan (uuetreérsneonlecrraa8217;Éillecva pantfli scaertaoasébsp;;:Ccola tes siésrdfà otaestdrlSamrdli 16 Juleer20153,&ursdnsqetde lus8217;Ésvfair ddt dsdueSDiisirrhnmpmlpdip-lupnle ,Cutiduva paceandeé. Psrl pRdut,,,ll spmoqsonsrne t oligu&#itepri le ters,. p>

LLbrong class="spip">JIRESUME DES AUDITIONSstrong>&/p>

WSBeese lsrsnph/,hmpm soelceoflinc tesu JuedJan Srsg lJrsnph/Pueiaeu altcaaussneé Mestetdeuprsue dCRNDDH,eaate léugedsc#qea éCSPJ,eigeaue sce Mitéssns lescadre de#ra#8217;ÉOnquêt st s onéeedP19-10-1988 Il vmcompaneleautjurssdpeprugedJes lsnnepvéheuicd,Jes lsnnepereantent lnàaCala reftrres lsa lais n/,plu#8217;iaEsèr , IBeese ls(aly paTi Sossaé)d#iamraebsp;;:C821721;dsdueSnpivnecmltgdP1999 mwndoksrnen jijnai.VLievoySampepkòl, mwndoai cmlspièv i,lmwndolrarjue dey dimbèkafdJur mlstftupivlspvin ande &mJur mm aksria,ySa eiè eerdmt é Jurtpa ani821730; Abuond jijnai,vnecmjouseaerly,Jerd ocosbò 6 zèvnecmmatecmlsplrlunecmbiwo, jiCdi ecf4-5 kèarèsemita ILpdaaaanvm dòqdpuòtpa ani,Jerdkala èmlspdòqd Seu jijnai kiautjursoksrli mahls/vii,espdaaagndohlofè sbr> sSveetles ak MètMcrdstqecmleerdplrluirsoksrsèy kòandJur ml abòeuidosySakiaksrsènelemadmnm akeu Mit ichlè Mcrteii,es lmnm akeinstrey akiadwcuèsiètMnecmtnbunles sbr> sNecmjeta141 jiyè0153,&necmmatec, jijnSèjvttMnecmtnbunlesnai,vlspdi fòkmlsplrlukala ètftupivlspdwcuande &madmnm lspoiiqtzasyodJur ml aloai ktre dtakeinstrejstqulea Rnt mmjousrèsemita i.VDwanse&accsmeprul sSèjvbò 2 zèvrèsemita ksrsapirsey apradoai eoiruMnecmpakèar.aR ecfnecmpakèar, mahls/vdwanse&accaaagndoniohlofè, nies kirt,,,llspgndoyodJkòtqum brluirsoii,eyodJheminz bln takeyodJkòl wtju Mottè mahls/vdwanse&acctuc sjaeerdmahe TDwanse&ac,JerdyodJmoe nkidplrluirsopweeta pngsMcshls/vdwanse&ac,JerdyodJNist ccaatwòl bln takevidotent TDwanse&acpdi Sèj,espdaaabezwndolrluakes kirt,,,lleerdmt é Jnecmmahls/vdwanse&ac ILpdé Jbò 3 zè, 3 zè edmivnecmrèsemita821730; Lèey adepss=,,lgndo2 lòtmmahls/vkiadpri ueeèyèey sbr> sLèey a rer nelebò 6 zèvrèsemita ksrsa, jijnSèjvande &mJur mm pradoirig i kiau Jnecmmahls/vspdar mm meé c#Jnecmmahls/vdwanse&ac IDrig i erd10mmamitMnecmy diakepng èmjo c,Jki makluagro-ièv i. Psdat otauirsowt sar mlrlukala ètfmeun de jijnSèjvplrluakemètMcrdstqecsMceun de jijnSèjvta leerd rer nelekanadm ILpdli mètMcrdstqecmslunecmbiwo mètMGariJListdvspdtucei ktre dtakeoiiqttrdyosMceun de l ontd&n doinstrejstqulea RJ RmueèsSanon/,dretziat crteii,eèsemydCinstrea RLoradoLamòtmakeyodJlòtmmesySai kò kiau Jnecmei ktrenai.VLòtmmesySai,JerdyodJmè,tpmdaaa n/jd&n do Sersowt sai,vpsdat plizyèefw éetlefòn jijnSèjvon nantfmeun de ldli dwanse, kòakwaes ak dwanse&accleerdplrl sbr> sLèeldi ecfaswèRnt mmjeta1i,vlspdi m aloahltdeéaiiqèdJur mlsmakeyodJgaonledlo. Psdat ln ntitaea,espdaaaanvm kapdòqd,llspgndtecmbwèRot sgaonledlo1i,vlspdi m lspiaiorevt taeiohlo sbr> sNecmvt redta212 jiyè0153,,&necmmatec, JijnSèjvta m dwanse&accta lebezwndol ijac IP ongndotnbunlesnjous pvltkòzeun pètMCht tl,s Lè jijnSèjvr ecfnecmtnbunlesnai,vlspf dpplrluakedwanse&ac,Jm wè jijnSèjvre teruizyèelòtmjijnur ml plrluakeyo,tun koubsp;;:CcjijnLamaIBeuizè, jijnWilnèJMtéec, jijnBèjvO Seirs , majtrea Ya,uk ILpdaarluakeyolemadmnm kpdaaaaijtfmeun de ldre teleKetioultbnse&Ketli sbr> sLpdé Jbò 2 zèvrèsemita jijnSèjvta otauprarlukala ètf ocoskala èmur mdolrluscstès Lè otaur ecfscstè,espdaran&madmnm ls,eu Mit liJansikapirseotaurrer nelekala ètfr pke jijnSèjvttMta leprarRnt nelemadmnm loskayidoktè samdi3,&jiyè0153,&necmmatec sbr> sPsdat ln ntitaea,emwndopapdòqdvnecmmbnmlnangm ln takeSèj,eseJansikapi Mit fiymlsma,Jki gndo41 ltgd,Jki vin re temvnecmnangm kteppmeerddòqdvac,Jbò inèJli maqecmur ml ta m papaplCmaldes Lè àd qst ccjijnSèjvta m leerdmturi,espdaaakapilrlubnsedseeerdpèta lpngajvii,espdaouptauirsoii,espdaipiuirsoii,espdsySai pi ,lzySa ekou Dïdlo,vlspdi l pl wè bnsedsei wè doubdsei eseyedaran&papydJur ml ekri,espdaaakapekri,emndol lgeglc i vin pèta ktrqst sMcsdmnm losgndtecmfèaceanchmmahls/vsairli,

WSKetly Jueiu/,sepoot bllmse#raIMEDMaràéeontre éea éCmmiqsonsrsrsele11h30&uDindtineedP19-07-153, LEd Dcciamraebsp;;:C821721;dNecmktdvapupdakekrlneè ectruiksyodJy aprsey n ònisatsfr ni maqeryèlsbiwo akesèisRgentènè,tpmwndole twtaesemvnecmtnbunlesnèsemydCestlncspuòtpa ani&la joàlvt redta212 jiyè0153, bò mita edmivksrsa. JijnSèjvu Jnecmkaedàdwanse&ac,Jlè àdkwazdtakelis Lè àdgdeuàl,vlspdi m lspbezwndom ijac, jody Rnt msMcwndolrpfèatpdaarluakelspnecmkou waeasMcwndoda lbsp;;:Ccmeaaaksrpai cmvtzajoul,s pnlmsewCmalde,&oàlieqttrdyonatpdefrssMcwndowèRvtzajolspblèm,tun koudyodJmoe nkidfdtigSai pi sMcwndoda lcmeaaakràéec/ O#osu/desor,vlspdi m se jody Rirseomplrl Mcwndoda lcmeerd rer nelepébl LEfèktivandJmwndoarer nel,vspdtuc sjaebò 2 zèvedmivnecmrèsemitaRnt mmjousvt redta212 jiyè0aunecmbiwo jijnSèj.sGrefySaipé cabsac ILpddi m tdeéndoyodJèsemydCei ktrenntles nt nmladdirsepssnifySayodJlòtmei ktrenakeinstrejstqulea Rnecmbiwo mètMGariJListd Mcwndoefrs cmlsbsp;;:CcmeaaakwèRwpé cal Jnecmei ktrenainSèj.sLpddi mbsp;;:Cci Mit,emvnecmki,Jerdbagayelpnmò.sLpddi m,seRpea sèlandJmètMGariJListdvkiau Jnecmei ktrenainakeinstrejstqulea . Tdeéndyeneot dretziat ichlè Mcrteii,eskeèsemydCinstrea RLoradoLamòt.sLpddi seeèsemydCfw ém twtaesemvnecmtuonrasyodJua èy.sLpddi psdat ichlè Mcrteiieerdplrluakels,vlspfèveksp èmkrahe vkia ocosnecmbouchmcrteiieerdtonbluirsovtzajomwndtftupivleerdplsduewèt liJe vt ovtzajomwnd psdat leerdfèmm menasl akeot skalé Rpeawòl irseeseyedimilydCi. JijnSèjvksrtinydJur ml ta mdsei eseyedeksplikdey pdosySaapilvnecmmbn lai kòtfmecmy pegzijedlJur ml meé ciuie&necmdosySaapit dréblemadi 16 jiyè0153,&la. jijnSèjvraksreppm,Jerd èlandJmètMGariJListdvkiau Jyonatpdjaddiran&pitydJur mlstfrèse sa, ot slòtmy ptluagr,diftakelis Pous pvkiaksrsènelecrteii,espdtucmenang akepnpi JmovRpeawòl TAoòsomwnd nt mmKetlitpmwndomn de jijnSèj, kòandJspdtucfèaal Jnecmei ktrenai.sLpdefrs cmmwndtferdDwanse&Remt RJ -ichlè Mkiau Jksrseyedl,Mkiau Jaksria,ySa tftupivs Jnecmmahls/vdwanse&aces lmnm akedwanse&acclipé cal Enupivlspdi mbsp;;:CcKetlitpmpiaiorem kapnturi SGelebagayekpdaioranvautjurs,Seu lòd y apasdàdwanse&acvkiadtkòJur mdosySaapine emadi 16 jiyè0153,.nSèjvksrtinydJur ml tabsp;;:CcAoòtfmeueerdgdeuàkòandJm tdekaaksrer ne kesyodJac, ar mm tdekaaande &moe nyo,tkidonku6;SofyinakerlivyeMcrteii,es lmnm akeMnstrey airsey atad qst ccnecmtnbunlesnai ar mm tacfèay aieyedaandeuigey apaavinstftupivm tachlèhe vyodJjaddirsedfrszuidosySaa.cAoòtfmwse&KetlitpmdaworszuijijnSèj, ar mm ekri ot sdekmraésyodJley airsopapydtfmwse&t tlnnuakelspmeerdanrejtre apl, meerdfilmcflftupivar mm gayuidosySaavnecmltès luit drwsepksyodJl821730;.sLpddtkò.VNrsopradoai eoiruMur mm pascP pkayilifscstèpjous pmta143 jiyè0153,&bò 8 tè necmmatec821730;..cAnvt olè samdi 8 tè maqecmr ec, mwndoae teJijnSèj, erdyodJdam kpdefrs cmirsedi JijnSèjvmalde,&li lopébls.cAoò mwndoae tedwanse&Remt RJ ichlè ILpdaaaefrs c Mcwndoef telei kòtflpdaaaefrs c Meu jisvdimanchm14 jiyè0153,&dwanse&accsmeprmJur ml ta sep glézJeiau Jy ,seRp pvkiafè l pltakràéers c Mcwndott drwsfittMta dwanse&ac,JjijnSèjvttMgndtecmdi m se laRnt mmdwanse&acvkiattMònisazemei ktrenaitftupivs JlaRnt mmdwanse&acvkiattMaksria,ySaSèjvoecmei ktrenai.sDwanse&accaaaefrs cma,ySc ILpdpito plrlueuidosySamaqeryèlsbiwo akeentènè,vn uple tmnmedpplrluvt redta2a Mcwndoef tejijnBèna Senol ekpddi m wi,espdkoflimtseRpéwanse&acvkiant nelejijnSèjvoecmei ktrenain. JijnBèna Senol ent mmdtkòJakeiwndofòkmgndoksiqsyodJackè,vkiant é Jurudfikeucetoot bllmttrdyo821730;. Mwnd nt mmKetlitpmwndoaaateerdplrluoecmeidyosMeu lèfmeun de dekmraésyodJdwanse&Remt RJ ichlè uoecmeidyo,akseppl dekmrasaysiaanvm gecmei ktretpmwndoiaiorem endiy ,seRp pvkiafè necmdatemadi 16 jiyè0153,&mwndo,,die &di ot sa laaksrnen duidosySaavnecmeidyosMcwndodasrszuièsiètMe vt otnbunlesnèr mm tdmwans...p>

WSMîtredàSamu Mcrdstqu/aclé tsstetdeuprsue éCmmiqsonsrsSateiiqtlrlullontdredta219 juleer20153, L 8217;Ésvnen cséateers Mcrdstqu/anv,élirvpreeeéeaa8217;Éillecva panéjàvdmssci neeBls rrsàids lea qlla tlleaNtéirngntàa ueécri,Rlepar ldet bée tnt, "l st pnprêdutanlaetde lc xntnbuele cursdncoflirmr1nn Doécri,s."p>

WSMîtredàSamu Mcrdstqu/anv,élirdipai ee dCugedJan Srsg lJrsnph/vu iàptntfli si ee orsc#qea ée ontre doudjueuta141 juleer20153,l ns luneéaladd,, symysihicftrreeci MiédelaMîtredàGrydéLisadeusca#8217;Éémgade&udjugedJSeg,ustcecnteiileeraaelaMchl endtuley/,varroimsauisoelceomplée eàmc pJplumRp pvcdtulde hdeontd&’Éillaclsemis &auaugedJan Srsg lJrsnph/ Ls tepredtulde hdeontd&npst,t821730;p>

WSMîie laMtdstqu/aclattréeuu8217;avutetdqn td qmcmbre ,sd qea écmmiqsonsràirleneéemployé&uàlysee tt,cciocmméetrong class="spip">JPFigaeostrong> ,dqtiduva par esémàursg l L dCugedJrsg lJcldipaceipnàoFigaeobsp;;:Cⷈ&oàlwè necmki mahls/vmdmt é ,sèr mm oco,ts Jnecmmahls/véwanse&ac821730;..821721;p>

WSMîtredàSamu Mcrdstqu/anv,élirremcsdndeanv,élientlvcaporooh.ul&l faelaies uDtregr,t td#ifu Mdur u&e lsni cese#ra#8217;ÉOnquêt .p>

WSDonse&RfyitdeJan ichl aclé tsstetdeuprsue énmmiqsonsrséateiiqtlrlullontdredta219 juleer20153,&esu1 h 40vca3 h 29.sDoncJrtdat tqe c=ééi odede h1 h 49Cinsus SLmNcmmiqsonsrsé8217;est p&npcui laeupai lu&e8217;Éuie cui8217;est paltenteeédJur u&i pd ,ander1nx rtec d,daor,gu’Éuie cuavt olnéjàvdmssci neeBls rrsàidereeande ’avuortec deur u&e rutdqcd22 juleer20153, LAor,gl dCdonse&aapreeeéenccsmoot bllmse#raa éCSPJ0ur ld ,ander1n#8217;iauretéséaonnet#loefceir le écmmiqsonsr.Ls8217;iauretéséaonnetpté tsdcomdeécuusctéléphone,Ma ueMîtredàE bertée#raa éCSPJ sbr> sLdCdonse&aa#iamraébsp;;:Cⷈ&mwndoaesevwavn upakeyoledoubmnanpobsp;;:C&kòa majtrea asi,eskekòa dminstrea oè821730;sbr> sAsézJkriineè uluvr i necmdate08 jiyè0153,.nJijnSèjvvins kteppmeur ml ta m lspbezwndom necmdatemadi 9&jiyè0153,&necmbiwo m psdat meerd rsevwavji dey pakeot sdifikilé csaaefrreza é . JijnSèjvu/desoreur ml ta m s Jijac, tupivs Jkoflins lyèltfr pke sdey dimtiyésyodJkiadwòl. ILpdé JnviewodJ10 zèv30&necmmatec sMcwndoaworszuilmur mdolrluyodJkooreur mdpplrl,s pnes kirt,,,lsadohlofè VNrsolrl,sbò mita edmivksrsa,&necmtèinstrerpdaaecfnecms lyndotnbunlesneaerlynai.sJijnSèjvraksreppmc i vikqum #raoiiqttrd sja,akseppn upySaapilvofig ierd ekirt,,eur mdpplrl,spito nr mlrlulòtmksep.cAoòtfmwse&arluakelspnecms ltoradoTle tee aCajti,eeèyèemazemi.sJijnSèjvrszuim kesyodJur ml mnde &m, èpke mcaaaefsevwavokt nmkt sfi sMcwndoefrs cbsp;;:C&on/ IJijnSèjvta m MètMNyt s cmSenjisvakemètMAde lcichlè ueirkluatiku400dac,Jerpsdat airkalivenènmae&accaaaefrlikdeirsedi pèsonajlsay apaakapdepss=,vksrsa. Lè opf dpplrl,eotaurrer nelenecmpakèar, n upeaaandjluoecmeeltoradoan sbr> sNecmdatemèkedta140 jiyè0153,,&bò inèJrèsemita,&beiinySaipdi n updwcufèay lebagaytfr pke instreèvedikésyodJdekéec/&arètMwtjuvltkòzer laganMCht tl,s cwndoblijeddesplnnuot sody saouro 48 èdtac Mcwndoeare dta kayimwse&bò 3 zèvedmivnecmrèsemita.aRadyolaaksué ,seRpeidyocAoeluvya FM sbr> sNecmdatejeta141 jiyè0153,&bò 9 vè necmmatec,éCSPJ0smeprmJur ml oiiqtzprmJefrrlnnuakovt emtnbunlesnai.dNecmnviewodJ10 zèvedmivnecmmatec,éCSPJ0smepri kò ur mverifySasa m r ecfnecmtnbunlesnai sbr> sBò inèJedmivprsor ecf2 zèvrèsemita, JijnSèjvsmeprm,vlspdi m leerdvins kteppm ILpdé Jnecmbiwo ac sjaeeSnpivmatec,élipé cal EMaysiawè ,s Lè jijnSèjvr ecfnecmpakèar, lpdé Jbò 3 zè 25vrèsemita, losga ltaihls/vii. MètMRigo Dipssndé Jnecmpakèar, mbn laysiawè m IBò 3 zè 35vnecmrèsemita, jijnSèjvat é Jnecmmahls/vmwndtftupivledi m ane&arlunt mmts kteppaei kòtfkivleta1oecmeeltoradoTle tee aCajti.sJijnSèjvrszuim nt mmkesyodJacei kòtfèpke mcaaaanvm efsevwavokt nmapè uospdirèkuospendirèkukia ocosnecmeroiwavegzekiif éla Mcwndoefrs cmlsbsp;;:Ccon/ INrsops=,vapep èm15vr015 insttJnecmpaki cleeltoradoan kpdaaongndopnpi Jmahls/tftupivotaurrer nelenecmpakèar INrsopsaanvm ei e dtandat eeltoradoan Lè oparer nel,vmwndo,,rszuijijnSèjJnecmpaki cltnbunlesnai,vtupiv2mmesySay akiatluakelspyolaeu Jyonaiakeki gndo40mmamitMirig,a ocosnecmmahls/vspdar mmeé Jnecmmahls/vmwnd sbr> sNecmdatevt redta212 jiyè0153,,&bò inèJedmivnecmrèsemita, mwndoai ktre dtnecmpakèaruakeKetlisJilnse&aclmnm akeJaklinMChtl, moe nMiyémivEralduirsopwojèfinrnismecmmateryèlsbiwo akeentènè,sMeu IMEDe k USAIDeki ofig inrnismecman.sJijnSèjvrare dtplizyèefw éomwndo7aru8efw énecmbiwo acpsdat meerdplrluakemedam y sbr> sVè 3 zè 25vnecmrèsemitaRnt mmjousvt redta212 jiyè0a, jijnSèjvsmeprmJusdat mettMnecmtnbunlesnai,vur ml ta m lsplrluscstès Lspbayimwse&nimewoéetlefòn pr ecfmadmnm lo Mcwndok embiwo m bò 4lts Jedmivprsor ecf5 kèarèsemitatftupivmwecmr ecta kayimwse&bò 5 kèaedmivprsor ecf6 zèvrswè.cAntf6 zèvedmivake7 tè aswèRnwse&arlu glézsMeu necml glézJbeiisvChekina,&necmdèlan 33im nahe TceaaaksrnmbwèRgwo alkòl, mt mmksrnmbwèRcosbyè0Ps ltijomwndtfakeyolebyè0kpdefrlu#11720;retziat ntr821721;sbr> sNecmdate pmta143 jiyè0153,&necmmatecmmwnd nt nelemadmnm nwse&ar pr ydeéantydJboje Mcwndoef tejijnSèj, mwndoaaajwt nmli Mcwndoef tei kòtfsdey diwavfmnm kpdefrs ctfsdemadmnm jijnai kiata m jijnai neé Jetlefòn lspnecmnanj,eiè errer neleleerd reprm,vlsptuc sjae9 vè 30&necmmatec Mcwndoef tei kòtfsadoefrs s. Ap demsu/desor,vy a rrs cmmwndeirsedi m jijnSèjvlopéblssBèna Meuz Lè pvlsptuc41 zèvedmivnecmmatec Mcwndoda meerdvinawè ,mlopéblss p.cAntrreac,JmètMcrdstqecmsmeprmJur ml enfòmemm ouvmaldeiejijnSèj, lspdi m se emorajiekpdaiop delpnmò IBò 8 tè 45vnecmrswèRy a reprmJur mdi m jijnSèjvnturi Scwndoef temètMcrdstqecmkpdkoflimtsmelpnmòma. Dimanchm14 jiyè0153,, mwndoae teKetlisJillnse&kiata m jijnSèjvttMta lesdemwndok dtucmennelelenecmy dei ktrenki gndoretziat crteiielpat l,daoòpke sdeusdat 2 sèlsfw ém ei ktre dtakeretziat crteiisMeu necmdate17voktòb01532nntles remt ivprnMwtjuvlttakenecmdate26d qst m01532nar mm tdelsssalyedartziat .cAnplii,lmwndojijneSnpivltgdP2001, mwndoao kò anvm lrluoecmkrlneè mètMGariJListd McwndonomRp ibatutioksiqsèpuòtpa ani&necmdate9voktòb01976tfrèsesaMnecmtnbunlesneaerlynnecmdate10 jenP2001, rèsesaMjijnlyèjMnecmtnbunlesnseol enecmdate31aanviydP2003tftupivm nomRpéwanse&necmdate16vmas01532dLMdaaaanvm ko nelejijnSèjv#oufriJokt nmmaldei.p>

WSMî u amsenrnrdlaS,sMVilstteBeegevO Serprs l,éugedscaàTisbuele cdpcrsmcrerqnIstlnc tcdpcrt-au-Prince, ,ln paé tsxtetdeusprsue énmmiqsonsrséateiiqtlrlullo19 juleer20153, LI Dvn pdciamraébsp;;:C&JijnSèjvu Jal Jnecmei ktrenai.sNecmei ktrenai, jijnSej ta sepyonaièlJmoe nkidtdemwndoagr,diftfsdemètMGariJListd, rèsesaMot slòtmy ptlubrébls.cLivmanifèstuc sziJur ml rer nelekanadm ILpdtcuande &ur ml sySjeemadi 16 jiyè0153,&ur ml td&nseyed rer nelesrsedfsizyodJletuc sjaerrln ILpdtcuande &nrsoksrsèy sa lepo ibJur ml rer nelesrsedfsizyodJan.VNrsooeuta lelpdaaondwcual JnecmeeyinyodJan.VJijnSèjvu Jia,uketflpdaarluakeot smoe nsr mdosySaa, mt mmmoe nkidpl&necmdomè/véwa.sLpdefrluFanft SGeleplizyèemoe nkidtdewè ,èJletucprarlunecmeeyinyodJan,tun koudFati/,tun koudurli,ySaDjo ni Rahl rluAcélatJrsnph/Puéps erruDtJuedJan Srsg lJrsnph/Puclé tsstetdeueprsue énmmiqsonsrsldP20 juleer20153,&lu#8217;iaEsèr , IEd Dcaabeauurup hésieéutan8217;Ééexrs mr1nuisn’Éiie cuareu c&ursdnsaPsurssaéddeta#aPsurssaéddues pvaleer&JvsoncaPuslsdi terè d&t prer&JgedJan Srsg lJrsnph/ LAès luvioi1né Memislceuoeoflinc tersue énmmiqsonsrdsla tciamraebsp;;:Cⷈ&necmdatejeta141 jiyè0153,&ai, Sègo alMnecmtnerly.sLpdefrlumJbò 2 zèvrèsemita ur ml ta m lspprarRnecmeeyinyodJa kayimètMGariJListd, ur ml aloai ktre dtakeinstrejstqulea Mcwndoda lcpl&al ELpddi m pl&enkyeeppmeu pke sdeéwanse&acvkeerdmennelel,vlspfèvéwanse&acvkoflyt sMLèeld ocJnecmei ktrenai,vlspefrlumJbò 7 tè aswè.dNecmnswloursmjeta1i Sègo efrlumJlspdi m lspaaakràéaksreppmc pvkops=,vnecmeeyinyodJanaksunySaapilpke spdsispèkmgndomoe nkerdksué s pvltp ta1oecmetlefòn lspac ILpddimvltp preu Jyonalotéetlefòn pr ml kràéelppm ILpde cdòqdvkala è sbr> sVt redta212 jiyè0153,,&Sègo alMnecmtnerly.sLèeldvinahlèhe vnrsoscstèpnecmrèsemita, mt mmvt redta212 jiyè0a, moe nkidtdenecmmahls/vsac,Jerdmwnd nt mmmadmnm ls,emlnaébleeèyèeakeu Mit nr mlnJansika,es lmnm akeAndèsonnkidtdevisoelst ccmahls/nmladdlèeldi ecfboudè,tptupivti Sossaélnaéblee vt sMceudeéndour mm arlukayeyoledoktè dèm oooògnntlespmta1matecm43 jiyè UD upivvt redta2aèsemita lsptuckòandeRpeiksreppmc pvkou Jiasloursmjeta1necmeeyinyodJan.VLpddi m necmrèsemitaRursmjeta141 jiyè0aPuswanse&acvboukeoef teleur mmn de ldkseppl yetfr pke ioe nyoeerdta nmli MLpddi m,slimmn de éwanse&acvkiakteppmoe nyoeerdta nmlist ske sdenecmpakèar IDwanse&accsmrs cmirsedi n doeRpea necmtnbunlesnai,vsluoecmkrlneè mètMGariJListd MLèeSègo e ecfnecmtnbunlesnai,vlspta m dwanse&acctuc sjaeirsovolecmmahls/vsptptupivdwanse&accta leaaakràarlunivakehlofèunivake ekirt,,.VLpddi m sepyo 2 sèlskidtdenecmmahls/vsac.aTi SossaévakeDjo ni éec/&ardta nmlienecmpakèar ILpddi m lèeldi ecfnecmeeyinyodJanaei wè mètMGariJListd, instreJstqulea RJ RmueèsSanon/,dichlè Mcrteii,eLoradoLamòtmakemètMVt rls.cLivdi m,scrteiieegr,dedlJur ml da lbsp;;:Cckosbò wmksrnmwè madmnm akeu Mit artziat l jije Mcnstrejstqulea RlaRnt m,vlspta sdemètMVt rlsckosa koztfr pke ldtcuan plèeduidosySaa.eSègo ta2anftdprsscyodJletp prac,élipblijeddtkòJleerdfèmyodJkorpksyodè uespscyesnèr mpasdàdosySaavjr mmndi 16 jiyè0153,&la. Lèeldf dpdtkòJa,mmesySay amn de ldki pvleerdbwè.sLpdefrs cmspdaaabezwndol,ySc IDwanse&acpdibsp;;:C«nbsp;?LrsokambwèRyonatpdbagaytfr pke i ko nelewée ombn Sòmting.bsp;:»Mpcwndoda l,elpdaaondwcubwèRe emadjluoecmmndomoe nsay Enupivlcsmrs cmirselpdi mbsp;;:Ccmwndo,,jambwèRl. Ap dsaeSègo ta2m lspaaaiaiorelekaaksreinydJéec/&dòqdvmt mmkste spdrlnty/&dòqdvyo,vlspiaiorelavivleedat jglc i vled rer nelearlunecmpeyiekanadm IAnvt olptuck emei ktrenai,vSègo ta2m mètMGariJListdve omèt liJyonatpdkaenki gndoads luvk&nimewoéetlefòn ii. MètMGariJListdvekri vk&bik,eyodJnimewoéespscyesnirsokatea Rnt mmlè0aPuanvt olpe omèt liJkatea sbr> sNecmrswèRvt redta2a,vlsptucvlednr mlrlunecmeelésyodJspksyèl, mt pmeu tcvle Mcwndokohe usoudyodJcoskalannuakeJvsoncaPuSègo laRnt m,vlspkohe usoudyodJlòtmkalannuot dret. Psdat ln ntitaea,ebò inèJlimatecmksrsa,&Sègo leve ur ml aloaipitfmeun de bok paepctonbluyodJèsemydCfwi,vpsdat lebese ur ml pradobok paep, bok paepctonblui kò Mcwndogndtecmleve ur mm outna l,er pke ldpanche ur ml tonbltpmwndomeé c#Jirsokalannumwndole kohe ua. Langc i vin lou Scwndoef temètMkayila kpdefteuot dret. cwndofèmansikapgndtecmaldre teti Sossaélkipdòqdvnecmnangm anlè0aPutupivm lrluoecmksiqsaryapirlisnai ar mm jwt nmspkruMur mm jwt nmmahls/var mme nelemtakeSègo lopébls.cMahls/varli,ySay apaagndogaztpmwndobayeyo klltaihls/vSègo a. Psdat seac,JSègo ur ptauirsoii,espdvoqd,espdsySai pi Scwndoef teplizyèeoecmfpnmiymliekpdnecmpeyiekanadmtakenecmpeyieday Mi SGeleoecmfpnmiymkiata m lrluoecmlopéblsskanape vè akels,vgndolòtmkiJksrseyedm lrlulopéblssPetif ètakeSèoultbnse&lopéblsskoqdnotès Geleyo ccnecmarli,ySay anecmmahls/vsacmkiata m lopéblssBèna Meuznai aiop d,daoelpat lnèr mpsemydCswnd sbr> sChakepneJSègo utjursofèRot sktrewòl kòJl ILpdaaaanvm #oufriJna lncsyn/,dniesik,ens ktlèstuwòl TDoktè SèjvVèlit=emksrnmktrewo cuot .sLèeldi ecflopéblssBèna Meuznai,espdkofeinydJvoqd,ey apradosecmeropfèaanaléz,ey ada lepa #oufriJsikens kè,vslulncsyn/ ldki wo Yo bayilifpikd,ey ameé csuwòmJur mls Seègo mturi,eSègo uèta lpvivl Meza mi,Jerdmwnd akeJvsikapkidpèta821730;.aTi pra edemm jwt nmjstqulesruple821730;..p>

WS8-etrong class="spip">JPFsaézsrsnph/strong>&,,sstetdeupldP20 juleer20153,,&t prer&f è dtaîndduDtugedJan Srsg lJrsnph/ LOrsé8217;est p&nntrretu àirle#aPsurssaédduDtcpatvrrruDtugedJ l&uDtroohvso sàn vt taaiuierc&ta#8217;iauretpsidCmédico-légal EL8217;ÉOnqtent faelaitlrluptntfcluea Rnésvsont si ee 8217;iauretpsidCsi àeylesaté,p xcfatsds-unsRgep/r mlu Canadm IIuprsuaipai eeertaoasésmbre ,sd àlivenrnlent., haïtrn vn pdot sft olewuraréspté raldrlfor.cdsedPcpatvrrruDtuged LAcuneertaoasemomt s,cil yupteudelaséi r se dmnre a iéaéDvbrpênangtsedPcpatvrrrucuèsicrc&ursdn#8217;Éémanspger Cs s20 juleer20153,,&edPcpatvrrr#8217;avuva par pa ontreu&#iteéasgvttsaéoes,ehaïtrn .p>

WS9-TDoctrsRMrsg lJV icolu/strong>,b&ràéeçue énmmiqsonsrsldPavmdta120 juleer20153,&luSitse-MarcdL qcmédecu/aclcoflirméai ee dCJgedJan Srsg lJrsnph/’avua#ouffrtée#8217;iaurcuntrivee temétaiulce tdospdeprctblèmnc&crdlio-vascult ,sd quisnpru CiursdNannée eaa8217;Éilleurslsl/aeô tee amédecu/a#raa éaelaiesdL qcmédecu/aclé tder lelaJgedJan Srsg lJrsnph/&1a#8217;iohôpéblssenrnrdlaMeuz l vmcnteitsd neeBlhémiplégie,dqtidrrr tsn ualuneamutetintlo#ra#8217;ÉOhémispèe ( cérébral EU ture lémédecu/a#raa8217;iohôpéblssavspsayéc#8217;Anncttspréor1ne tclchldduesCT Scandqtidrrr tsn ualtcaaueu t n duan Srsg lJrsnph/Punmpmlpe c=élgeg ayt mstnvthiaretu&#s ot sl8217;ÉOhémispèe ( cérébralDeoi s p>

Wd10-eMîtredàan SWilnr1nMtés/vclé tsstetdeuprsue énmmiqsonsrséateiiqtlrlullo22 juleer20153,aauePslai dursJticc.ceqial#v,élirdiamraébsp;;:CⷈBiwo m twtaesel2anftdpbiwo JijnSèj.sBiwo jijnSèj utjursoefteuluvr i ltkòzelpdaaagndoklimatizè.VJijnSèjvutjursoe ecfnecmbiwo anvt omnuisnke lderd ocoskala è,espdsveetlepradobonè Scwndont mmse&bò 8 tè 30-e9 h&necmmatecmmoe ec sbr> sD upivrèse dfsizyodJletuciran&pr mmn de fpnmiymcrteiieekeinstreivenènmae&accaaiètMnecmtnbunles, jijnSèj utjursoerdmade &mJsiedfsizyodJan kòrèk Mcwndoda lcdfsizyodJan bn/ IMèkedta140 jiyè0153,,&jijnSèjvta m dwanse&accenolt c#Jnecmy dei ktrenoecmkrlneè yodJmè, airkatfakelòtmmoe nenke ldkl&al Ecwndokorseyedlnèr mpaJal Jnecmei ktrenai.sBò inèJrèsemita nt mmmèkedta140 jiyè0i,vlspta m lspfenkd ocJplrluakemètMcrdstqecvlspta m kidpl&orszuiakeei ktrenai,vuisnke sraoiiqttrdpeyier, n upkapab utjursodyesog Ecwndoaaaei ktre dtakelienecmjeta141 jiyè0a.sVt redta212 jiyè0153,,&meueerdpradosyèjMnecmtnbunlesnoremoe ,&necm i Petyons Lè àdr ec, sesnai aaoklimatize,cmeaaakràéec/ OMwndo,,die & rer nelevin jwt nmdwanse&accnecmpakèaruur ml rgrluzafèasyèjMa Mcwndoot dei ktre dtakes lyndoksiqsèpManès0kpdefrlumeur ml ta m ksrsabsp;;:C&r mpaJun de Sèjvu Jal Jnecmy dei ktrenayè0jeta141 jiyè0aes lmnm akedwanse&akeyoleba nmlòtmoiiqttrdkiafè l menas&akegwo rsscyodbsp;: ?s Lè àdkwazdtakeSèj, mwndoiaioreleia,uketftupivledi mbsp;;:CcmodJheè,vsluw upkieudeéndorezon,pmeu tcdwcual Jnecmei ktrenai.sbr> sLèem r ecfkste dwanse&ac,Jmt mmjousvt redta212 jiyè0a, mott drwsfittMta dwanse&ac mwndookr lacclipé cnt nelejijnSèjvoecmy dei ktrensr mdosySamètMNyt s cmln takelòtmmoe Putupivm ko neleei ktrenaintcuan plase IDwanse&accsmrs cmmwndeirsel tabsp;;:CceRpea ksrsapsaou Jiasl, meerd rmsew,eur mdpplrlnsr msi.sDwanse&accaaaanvm eflppm ISe ur mrezon sa, lèfmevin un de jijnSèjvmturi,emwndomn de ksrirkasyodJa pnlmsejnéer l jijey sbr> sLèem r ecfnecmody saoea,emètMVycuande &md quòt &md qidosySaa.eMwndo,akò,&mwndo,,die &eare dta kayimwsesMeu necm pmta143 jiyè0153,&necmrèsemita, yodJcosfpnmiymmwnd arrlnnumwnd lpnmòmjijnSèj.sM eflppyodJlòtmjijnur mkoflimasyod IAnlyndoksiqsèpGa pndkoflimtslpnmòma.Scwndoef tedwanse&accalizyèefw ,espdaaaanvm smrs cmetlefòn sbr> sNecmdimanchm14 jiyè0153,, bò 3 zè rèsemita, dwanse&Remt RJ -ichlè Mefrlumeur ml ta m lipé cl gléz,seRp pvkafè l pltakràéers cmetlefòn TDwanse&acpdi m lipénde &y tp ta1pnpi JbagayeirsoipnmòmjijnSèj&la. Lèemamn de ldeksplikasyn/,dlicsmrs cmmwndeirsel tabsp;;:CcjijnSèjvttMvins ktepplJur ml mn de ldksrsiléésyodJsr mdosySaa.cAoòtfirseet emtwòrdmt é -elst c, lsplrluakejijnSèjvoecmy deeltoradoirsey apal ELèey pf dpplrl,ey a rer nelenecmtnbunlesnai TDwanse&acpksrtinydJur ml ta mespdssziJénde &y ada retziat crteiietlunt mmfahe vnecmei ktrenai,vtupivs JdwògélipblijedksrsomRppr ml krlmc sbr> sSe ot sa laaksrnen duidosySaa821730;.p>

Wd11-TLSainstrease#raa éjticc.cdsMdàan SRnéesSanon/,dqtiduva paé tsrs éprsue énmmiqsonsrséateiiqtlrlude sraair ddmcompanelerprsue csn moot bllmsse#ra#8217;ÉOUSP,e#ra#8217;ÉOUSGPN,e#raa éCAT TEAM,r#8217;avuva par painforméasgvsr tes, l&ele#arPrlicdJqi8217;Éillei va paec icolv dsn moot bllmssdL qc r tes, l&ele#arPrlicdJptntfli si ee Sainstrease#raa éjticc.ce#trutiduva par pacsdnaucnmurt t IAucnmursc#qea ée ontre d,asgvsr tes, l&ele#arprlicdJptme lsspsayéc#8217;Anvreesr1nx ltéléphoned dsn moot bllmssdLcs q,e Sainstrease#raa éjticc.ceu iàptceandeéndeanear paindesorr,Ma uceai eeersn moot bllmsseit dorctbab int nriartiélic ldMchl endtuley/eur u&e rCap-Haïtrn vc rutdqcd22 juleer20153, p>

WdLSainstrease#raa éjticc.ctciamraebsp;;:Cⷈ&meun de oecmeidyo,ayoddi m tderreza vnecmei ktrennecmbiwo mètMGariJListd, kstd&jijnJ RSèjvJozèf tacu t sipd Seumy dei ktrenimajtnè Seumy deevelésyodJpost-montentfsdey dpleza éritfsdey dblge Yo nt mmda jijnSèjvtacuste drig pr mmwsesMnupi,my dei ktrenksrsa,&omwndomètMVt rls, airkalfpnmiymladdbleewderreza sbr> sJijnSèjvu JelssziJduidosySaa,daoòcmeaaawèpirsekia avm tacstetr,dedakejijnSèj sbr> sAnplii,lGariJListd, sdey dairkatfirsekia avm tacoblijedlrlunecmbiwoplJur my dei ktre,mm tdekaaenolt c#Jnecmbiwo mdLct mmsivm ko neleads lukrlneè mètMGariJListd,m i eèyèerezèvw ,eot dret instreèvpssnifikésyodJan,pmeu anvm lrluoecmkrlneè mètMListdvna lèmm tdelirkatfni psdat meinstrejstqul sbr> sMou Jialluakedwanse&Remt RJ -ichlè ,vlspta m lsppltaokr laccduiokt nmei ktrenksrsadLMdaaa n/jd&kiatènydCfw ém ei ktre dtakedwanse&ac IArer katfnppltaei ktre dtakedwanse&acRursmjeta141 jiyè0153,&la. Pous pvkiaksrsènelenoqdnésyodJjijnSèj, sdCinstrePòlUD uiskidtdenoombn l,seRpea crteiiekidtdenoombn jijnSèj.sM pipdi crteiiefèmmaiorer pke lddivs JlaRkidtdenoombn jijnlr, mbn slnsr mivenènmae&Peevesnai jijnSèjvttMnoombn.821721;sSe pmta143 jiyè0153,&necmrswèRnvttMokr laccduiipnmòmjijnSèj821730;..p>

WSMîtredàtrong class="spip">RMLamturstrong>&,,sccompane bee amîtredàtrong class="spip">RMThéodorestrong>,b&#v,élirntfli bsp;;:C821721;dnecmdatevt redta212 jiyè0153, bò 10 zèvedmivur m41 zèvnecmmatec,énwse&arlunecmpakèar, mwndoai ktre dtakemètMctéecvkiantt &mdokr laccduipakètprsscyodJjijnSèjv#bunvnecmei ktrenaiou Jiat sipdnayè0jeta141 jiyè0aeoecmkrlneè mètMListd,es lmnm akelòtmoiiqttrdegzekiif éla MLèem r ecfnecmbiwo jijnSèj mawè ,mp ydesr mbiwopldseeerdplrluakemètMcrdstqecsMcwndole aksria,ySaakeyolemr n.sM iaioresdey dpawospdkoflins lyèltfmcaaaeftcfnecmbiwo a. Psdat madepss=,,lsenSèjvkiaraps euivmmwndeirsel taumJbagayey a èd, ur iwavamfahe vpnpi Jktrenaioakekn pdcwanse&ac IYopdi y afahe vpkedwanse&ac,Jr pke lddistnbunyuidosySaavbayijijnkpdaaaaij ur iwava IJijnSèjvta m MrteiieekeLoradoLamòtmfahe vr pke yodJjijnvledvoySamadmnm akeu Mit artziat necmprizoc IYopegzijedur mdosySasapine ewèpawèvjr mmndi 16 jiyè0153, IJijnSèjvta m sluoecmkrlneè GariJListdvei ktrenaindewoicd,Jmbn GariJListdvakeinstrejstqulea Rpltaagr,diftakeli,lsenMrteiieekeLamòtmkiatluagr,dif IJijnSèjvta mPuanvt olpdepss=,,lmètMGariJListdve omèt liJkatevizit li.VJijnSèjvu Jmtre dtgrefySaSaj lukrtevizit ladLMdkteitsde jijnSèjvttMia,ukeai pi sbr> sSpmta143 jiyè0necmmatec,énètMcrnès0efrlumeur ml ta m jijnSèjvfèmyodJStwok,&li lopébls.cLivdi m,soàlwè kòandJnègnyoeenneje.sM eflppmètMcrdstqecmspmta1swpvkiaksrlimtsmeSèjvnturi ScètMcrdstqecmdi m leerdpradoatoot bllmttrdlJur ml denteiiefè0a.sbr> sNr mpaJdwcubliy ,slèmy ptlubayeksiqsèpLyodè uKteitsn Bobrndtfaktyèlssr tktè egzekiif éCSPJ0 ,esòd ur ml aeftcfGay aDòsenol ,vsluoecmkrlneè GariJListdvur iwavamte ksrirkppmètMBobrndmeropfèadjòb sesnsa. Psmi moe nkidtdenecmei ktrensilr, udeéndbsp;;:CcisemydCinstreGariJKteiy,MGariJListd, instrejstqulea , instrezafèaeanspjedlekia eeLoradoLamòtmakemètMBobrnd Lè pva,emètMBobrndmu Jelsie & romèt deiqsyodJ ,volye ldtcuvyo culalwa.seu lèf pvy ptlunoombn j RmueèsSaeneiisvksiqsè p>

WdL énmmiqsonsrséateiiqtlrlue8217;est paye uàet1a#8217;iohôpéblssenrnrdlaMev/0ewurar ontre due csn moot bllmsse#racecnenease#raauissPuslsdi ts Dr.etrong class="spip">JPverrystrong>,b&r20trong class="spip">JPndtonleBéblrstrong>&,,sr20Dr.etrong class="spip">JPAri eHenrystrong>,b.VNrsluvionshdeontée pseeirselearvic dse#racecneneas,riarticulrèrqnt nr#8217;iavcouel ,vqial#v,élrsuaisst nafonesn tnr1nn onle ,dprsincipdse#radésrerlogidCmédiclrl sLeeu t n duan Srsg lJrsnph/tpté tsddcsdn1a#8217;iohopéblss teavmdta143 juleer20153,&lu3ïeue (,euDindtinersueDr.eLidat ThéodoredL qcu t n dupté tsrapie nt nris lendohlrg,uprsue csnarvic dse#8217;iaug,un d Il séts laeuoeomirremfond,uec llmyodesmbilatérls.p>

Wdeuonle 8217;Ésvnamnèsrdeffectuéuprsue cémédecu/a#ragadeu,pluèsicrc&esccs tet dodueu t n d,cil #8217;avyaapilpteude8217;Ésvntécédet dopsel tnrlse#8217;iahypsetu/deodJartéi rlrl,eoie#8217;iauru amsrivee tsemétaiulce tsRnésvsontt /ne euiviCmédiclr régueiur.p>

WdNrsluvionshlsoscsnimaedsc#qeCT SCANe#raa éboîtlucradnne.a,Jmtre t /ne hém oomtsire t-cérébral,uec lloedèmc=ééi -léonsrneldrrr tsn ua lnàae c=mtse ecfhémrr agidCcérébral agahe ,uec llompasscin ontdtnbcult , p>

WdLSadine oicc.e#8217;iaAccent M Vascult , CérébralDhémrr agii eegahe st pnposé Ls t A.V.C.rremvtdt msrctbab int nr#8217;ane cfhypsetu/deodJartéi rlrl,eétt /ndeprct oicc.ets lunnre 2,r#8217;avupilptpu&êe lé 8217;iarbjenr#8217;ane cfncttsvtdqn tdchirug,iclrl,nn onle 8217;avuvilueeddexpsetsaltenteesPunmpptgvttiue#ra#8217;ÉOéttttclcnii ee l&uDtbilanueeddexamnésalte-oééiaéoes,sdLcslgréets lescsnauissfnctt/defs,tige psetentrifvdsc#qeréadnmaonne,e terst n duan Srsg lJrsnph/tt pndécédéacecavmdta143 juleer20153,&lu8ïeue (,euDi r e sLesémédecu/mcepatechnicesnse#ra#8217;ÉOhôpéblss#8217;avt dorlptpu&seprct on dràirleurcunténènint nrq pdaouraltcaévtdqlla nt nrisécéder&r mpemvoquul&l fps eté,poue énrislchypsetu/devg ayt msmnduirpt1a#8217;ioieitsllaonnet#lol8217;iaAccent M Vascult , Cérébral p>

WdL énmmiqsonsrséateiiqtlrlueau a#8217;ÉOnspsaél#8217;anvenrntuse dfsn moot bllmsse#ra#8217;ÉOhôpéblssenrnrdlaMev/0q pdt dooffrtéeàe énmmiqsonsrdsl, l&totlrluepafranche collaboraonne p>

WdL énmmiqsonsrséateiiqtlrluasstetdeupldPmrdli 23 juleer20153,,&mîtredàtrong class="spip">RMrsnph/tcrnès0Loui/strong>,b&q iàptciamraébsp;;:Cⷈ&necmdate10 jiyè0153, jijnSèjvsmeprmJur ml ta mespdbezwndom Mcwndoefrs cmls meerdplse ktepplJkala è sNecmdatejeta141 jiyè, mwndoaarlunecmetlefòn akemètMctéec,makemètMBobrndmkiata m ei ktrenant jijnSèjvakeoiiqttrdyodtucfètMkayiGariJListd McwndoaarluttauirsodosySaa,dak Fito kia eevwazdn akeaworr ydtè kayekstenSèjvsmtlua sbr> sVt redta212 jiyè0153,,&Fito ta mespdwè Sèj,espdaaldtakeSèjmkiata l kòandJspdregrèenaiou Jal Jnecmei ktrenai,Jr pke ldiaioreleiatbnse&nt msMNecmrèsemita, Sèjv#otifscstèpakemsdmnm losakeu Mit li.VR ecfaswè,espdaran&zam kpdtluoecmmndo ekirt,,esnai sbr> sSpmta143 jiyè0153,&lè meerrlnnuSèjvmalde,&li lrlulopéblssenrnrdlaMev/,&mwndo,,dt ccnecmlopéblss p=bò 10 zèvnecmmatecmur mm arawè ,s Men&lè mer ecfnecmlopéblss p=yoddi m eRpea lèevizit p>

LLbrong class="spip">JIAnalysdueSDuslsnée ereouel eiuse orsc#qsnx rtonnesc#qsnréirns nigeaes, lse#ra#8217;ÉOévénint nstrong>&/p>

WSDee 8217;ÉsvnalysdueSDuslsnée efourniesprsue csnréirns nigeaes, lse#ra#8217;ÉOévénint nsxtetdeusp1a#8217;iooccasn td qmcx rtonnescttiucsnrt taausSateie#raa éRépee ii eeq nsd sao#8217;iauru amsmooaccsnaronle aopsel tnrvcap rtonnenrr,MsaodasrsnibilttrdetsedPdegréeelaséiénntéenésvsot , ursdn#8217;Éép rtonnedetsedPdéroicdnt nr#ra#8217;ÉOnquêt aeuogénérls. Lpseeiffétet doréirns nigeaes, lsep rtonnenésl#v,élt dorercsdndeaompassde lcqi8217;Éiluèsicrc&euPmrdli 02 Juleer20153,,e dCugedJan Srsg lJrsnph/, ayt msis lelameecsan (udeaoie eàmcompanrîtredà qmcgai esénmmiqsr#ra#8217;ÉOatsdPuclslsnéae c=impulan (utsué siarticulrèrqaluneamufair ddtnpereanec debvnala,Jmai dqtiduva patsué lescsnpossibilttéao#8217;iaimpsnp1ne tvirgeg à 180Pdegrésp xcfft o nigeedsé leség xcfeparulctce tsRtnpHaïtr Il sfa saignalareq nsdèssedPdéiart,&l faelaies ltenent Miie cuares lets luausséi r xelamee on iaonnetportéuprsuemîtredàNewtnetLoui/uSitsesJticeàn vt taleénmmiqsoir dd àlivenrnlent., dpcrt-au-Prince, ,lmîie laan SRnéesSaeneiti,eft iaio éttttdeaomrruponnedetsdeaomncusonsrs xcfru C haué lespèe (sr#ra#8217;ÉOatsdPuidaexantp1a#8217;iooccasn td#8217;ÉOéps erretsedPfildodueutenent Me#raa éRépee ii e sLaeutenent clue8217;est payerivevéuidosuausmureq ndeu#171;nbsp;?Ll faem soelcCéssueclé tde tdo e bsp;:»Mpl sfallaiensricrc&esa#8217;ioipansse IEolewuracraair d,ets lescsnmonsesséts e msmnr tesmcepatsué lescsnrivepdseéts e msmobiltté,s. Ueamufair ddq pdaeunriarîtredàsipal,p xcfyr xe#raceu iàqial#luea par parivp ceai eeslsdi ts mét redsc#qea érulctce tdLcs qceomplce édJur u&qialea palr ddmc ll qmclneaté lepsychrlogie tsR ts aconnesceàeyleconnescrulctce tsRns luneéattttdoqdnéprsue cégai eebvnrtonsmd,asgvmées ledueeoi sretse8217;ioieeecent fimpunnté. Qialelsd-ildo ts aco, lseimplce ésRns luc teprufair dbsp;: ?p>

WSI.-pl se8217;esagilaeuoot spsmcreralreudelaMdàNewtnetLoui/uSitsesJtice.aanneametsbraiet taavoceie#raa écapéblse,tlleaNroimsa u&i pd 8217;ioietonp1ne e aconneaeuojticc.ctntre do.ceqialànn Doyr xei pdrsuaissa painacceptllms.senauurup deprsel tnrsRtnpr ess e msmsetus,Jmai dts lupeudelagnésalnéss e msà air ddq oiai eeerCsi àeàmpempsn&esa#8217;ioufair d p>

LLII.-pcs qc#8217;ioufair d aaviepré tdass="élueanlsni ceprsue cénmmiqsoir dd àlivenrnlent., d8217;iou orscMlaan SRnéesSaeneiti IEd Dcaarebodqcdndo eptbre ,nigeamtneînddqlla&#s oempluvit /ndepefceir le c=impulan (uiarticulrèrqa#qea érarnr#8217;ane aoieonse&ciocmméeEnold F oreitsl&q iàptft ole c=oieaonnetpusmnr tesnsrnel p>

LLIII.-pQ ndeu Dc02 Juleer20153,,e dCugedJan Srsg lJrsnph/, ndohlrg,upesa#8217;ioufair d ansricrlelsCugednt., vit /ndr dd oi s,uneépeudot sl JmtrddJptntm sncéeàmpeesst n le c=oempt ajuridico-rulctce tdLSuivt nrq la&#ssvjr rnpru Cnrtdla#8217;ioureesdelaMdàbrong class="spip">JIVt rlsstrong>,b&r20uDtcmmiqsoir ddbrong class="spip">JIDélleerstrong>,b.Vcs qcon slnsr visde asi ee 8217;iaufair d #8217;avupilpté tsrrn vqi8217;Éie c=sipal,p conneaeuojticc.c. C8217;ÉOétt ole c=ufair d éqdnem sntérulctce tdLA orsc#qsnmonsessrulctce tsRn va sntéêe léulit=eé/0ewuraobttirc&escctenultsdssrctbat d p>

LLIV.-pC8217;est paoaséiu’Éuire duo nsxtjueuo ts gai esénégotiao, lseqialànèsicrc&euPmrdli 09 Juleer20153,=imps mr1o /ne ure lénmurscàea ée pteiiede&l faelaies ltenent Miie c. Ds luc teprsagaajuridico-rulctce t,eertaoasésse urstonnena sntéewuramsee tc&esccsrnstssrulctce ts,daor,gu&#eo#8217;iauru amssluliveva sntéecmurstonne deprsedase#raaéi r xesrnstssrulctce tsbsp;;:Ccmai dts les u&e re eroasedueeoi s LAor,gl cr xeqialenolsagea sntéa érussibiltté deprsedase#rccsrnstssava sntéot sdesni cepompasi eaa8217;Éillefallaienulit=etc&me lssnpereanec dee re eroasedueeoi séewuraévie eàdeprsedas.Ls8217;iauvoceie#raa éaelaies ltenent Miie cuayt msft ole c=piêe lépreitsonne ract é -t-srdsllefallaienns luc teproééiaénne àea éfoipté rce éd,ceomplce édJeparéraier se,aair ddmreesdàdelagrussnc&cylieeré,s.p>

LLAuson,e csnarvic dse#8217;iaunégai eecrlneepan paé tsreqisnprwuraa,un drJepacoord tnr1n csnligndse#8217;iaatta&#eo#ra#8217;ÉOéqisplunt écuuscsntre.p>

LLV.-pL/aeô teeuecrlneepaelaMdàGrydéLisadeusdi séêe lénmpasi ens lusaodamu/deodJhiltorce tdLCeecrlneepaalnéjàvé tsulit=eéprsue csnarvic dseivenrnlent.,a xeqii eellefallaienexerctc&esccssscin les u&e rnmmiqsoir dd àlivenrnlent., dpcrt-au-Prince, d8217;iou orscMlatrong class="spip">RMLn esdCteitsntMBourgrnsstrong>,b.VIlduva paé tsceandeénàaceu i-cspdeprctcéder&ta#8217;iaurreitsonne elaMrbsp;;:trong class="spip">RMGaaieot Dorsoasvilstrong>&,,scnen csutenent Me#udCteielleÉltesoralDProolsor ddq pduva paornisatée pseéleconnesca xenmursc#qsqlla saMrbsp;;:Mchl ersnph/tcrtuley/et pnpasvtduàmc pJptenent cludueu ys.pC8217;est pans luc ecrlneepaaa8217;Éipteudlreuda éeéunnne àea qlla tava sntéiarticipéasgvrsmcrerainstrease#8217;iou orsc(trong class="spip">RMGaydéCteleerstrong>,b),lelsCinstrease#raa éJticc.ce(trong class="spip">RMMchl ePreraseBrunahe strong>,b),lelsCinstrease#rs Afair dpté range (sr(trong class="spip">RMLautet S. Lamote strong>,b),le rnmmiqsoir dd àlivenrnlent., ès lue risbuele cdpcrsmcrèrqnIstlnc tcdpcrt-au-Prince, (Ln esdC.MBourgrns),tigcdLCeecrlneepasbree rêe lé ealreudelaptedileconneà qmcgai esénmmpeotstntre do#8217;ÉOéttttdeeeoi srenpHaïtr IL énmmiqsonsrspteudlamnangcrretsedPpr eilègse#8217;iouer le8217;iavcqllavrsmcrerainstreaseLautet S. Lamote sccompane bee aru CiursdNmbre ,sd qeelsCcrlneepaen paMchl ePreraseBrunahe . Tv,élt docoflirméauer liarticipéaluneameéunnne àec ecrlneepadu oempluoùle8217;ianeéatt srmieitase#rs afair dpté range (sretse8217;ioure lémnstrease#raa éjticc.c LI Dv#8217;avt domsetusorlptprecsaée pseuaisnesc#quc tepreéunnne ndo,,horsc#qsnloce xe#rae8217;iouminstrea on (uiee ii e Vcs qcot sl JmtrddJsaipai eersue éni cepe rnmmiqsoir ddBourgrnsaalnûlnéiqsonsrn eàdepsodJpostpredt llecva parefuséeelasv,écrr ddm xe#rmn desd qee lsnipéi r r,euDinomt s.p>

LLVI.-pL8217;avt aompassde énûrint nrq la texpsetislcceecrlneepaalnûlnéveloreerids lea eedsénneà qmcdussiseleivenrnlent.,a xeàcsnt rlse VceéLisadeu, ayt mstnusaopussnconsrsulebad,upesanteiileeraajuridi&#eo#ueutenent M,vsludi sédeéjticcfrerasodJcot ,nigeaeun-êe léson salt , VIlddi sélivevul&l fsricreajuridi&#eo#8217;ianeédussiseCugeéérulctce tdLcs q,&y tva p-lleneédétwurajuridi&#eorussibleRns luneédussiseCoùledCugedJndohlrg,upalnéjàvéiqsrusCugednt., vit /ndr d-eoi sbsp;: ?p>

WSDr xechossseit doàvsmtlirc&ici LA)L qc ussiseCltenteeele c=imagear parivp pempreodueutenent Me#raa éRépee ii e,e#ras éaelaies,detsdeason uminstrea on (.pl sfallaieneopf di1nx lru Cnvt,,eur liass eàdepc teprdistn conneaà ure lénhoss.pcs qc#8217;ioufair d allaiennuter,redt scsnribuele xeétt /nelevacngcrélic ld#8217;iooenrntuse dfsntse snc&criinela sa Dc08 Juleer20153,,e 8217;ioureesdncttsjeéddetarsue céPsee ttdetarsue 8217;iauvoceie#raa éaelaies ltenent Miie cu c=seraieneoetdeup’Éuir oesobrqalua éeéoenrntuse dfsnribuele x LOrsnmurt pae orscl/aeis&#eo#8217;iatdeu due csnipplicdJ qmcgornnc&chau#rccsr lenolrontrivisnmoipa ontre.sDoncdsllefallaienlivevul&leédétwurajuridi&#eorusdnsricrc&x lru Cnvt,,eesa#8217;ioipbroglioajuridico-rulctce tdLAaséi,e Sainstrease#raa éjticc.ceclcoflirméaaucnmursc#qeson u rtonnedaa8217;Éilley tva ple c=sricreajuridi&#eosipal,. Lpseiartie/0q pdt doft olureesdsmti duo nsl, l&urees LI Dvdmsscir1o /ne esreqit aauCdonse&dxntnbuele cdpcrsmcrèrqnIstlnc tcur u&i pd ,ander1nudoefugeédL qc onse&assde ée esord tnnc tcabrévirifvdd ,andet taausugedJe eiègsespecse cursdneoetderee 8217;iaufair d àl#v,veausepaoaséiuobttirc,soàlbrn vqieledCugedJsdPdéior,,eesa#8217;ioufair d,soàlaa8217;Éilleém teprunl#v,veausugednt., q pdssdveraltcaa éaelaies ltenent Miie cublanchi,eesa#8217;ioufa1o /n#qea érlitsec sbr> r> sVII.-pRien duiot sceuaaneareunrsraair ddeanls 8217;iauval,u csnippor,retse8217;ioimplccsonne euCdonse. Voilàcursdq oialqc onse&an ichl at panevtduàleprsel tnageaneneae cdpc#8217;ioufair d Ls8217;iaureesdayt msé tsncttsjeédd Dc08 Juleer20153,,e ePmrdli 09 Juleer20153,,alqc onse&an ichl atre dosnpecon (.pl sract é eàe énmmiqsonsrvqieledCugedJt pavtduàleplivevul&ns lus dbu daucur u&i pdpsnp1ne eai eson (.pcs qce8217;ÉOétt oltla nt nrsu/debrluepacoflint Miielaa8217;ÉillDvn pdcûets lescsndr xeqiattr1n csnloce xe#ueu lai dursjticc.cerwuraaeeraatnpr esr1nxaier rs LI Dvit do#8217;ioubordriartiélrselelqsnloce xe#rae8217;iounen cstnbuele cdumtnerli SLà,e dCugedJciamraeanear paerd enerc&ta#8217;iauierretsriamrmlpe smooacclru Cnsurssaét , VIlseiarte msà #v,veausrselelqdeeltaurt toTle tee aCajtimlu Champ depcrts LI Dv#8217;avtre d dorlptds leaqdeeltaurt tdsllsn mote msds leaqdvéhicul (ceu iàeuCdonse)sds lea8217;iauiase#raatsonnelent., dudeeltaurt t IAusonv#8217;avtsp-llerlptpussibleRnqdvércfreraic ld#psetenunen eleai ccsndr xecliet dosmcsee llmsseava sntéé tsreçuluc ejr r-là.pcs qcllsnvo nsxtjcealreudsecreséewuraair ddq oibsp;: ?L dCuged,ldipalqc onse,r#8217;avuva paqi8217;Éie c=seul i eson (&ta# pdpsnp1bsp;;:C«nbsp;?LAviez-vs leéeçuedfsntreessc#qsngnésaducur er lexursif écon drnt taleéugednt., q eéu8217;iauiaye uàbsp;: ?bsp;:»MpPsel tnrvneaompassdeneopft olewurq oiac tepri eson (&snpereanec deanodind #8217;avuurt pailptpu&êe léposé aauCbu dauceuCdonse. Mai dursru Cl dCdonse&aflirmrlaa8217;ÉillDvit doeeltéleaàsds lea8217;iauiase#raatsonnelent., dudeeltaurt tJrtdat tqvingtCinsus lewuracrteprseul i eson ( Il sfa scror ddnmpmlpe rnangtdàGryoàlaaebsp;;:C«nbsp;?LL JmtrddJt pastone bsp;:»Mp>

WSCertdat tl dCrecstruDtugedJànn Doaiqsrsnp&êe léeiffétet e#raceu iàeuCdonse. PwurajuedJan Srsg lJrsnph/, i aclé tsmnduirpt1ae esreontre doic ld#pseuvoceise#raa éaelaies elev#eo#8217;iaêe lépseluaeéndear ontre due cainstrease#raa éjticc.cecxcffiesc#qulivevul&e c=issu eàe énrislcpemvoquéuprsueelsCugednt., vit /ndr d-eoi s LDr xejr rnpru Cnrtdl,ledCugedJt pamnduirpte c=foiptursru Carsue cé onse,reanlschauff, l&nivaget e#rasurssaéddausme lseeltaurt tdsàe éme lsuiase#raatsonnelent.,. Tv,jr rnpn onle ,Cdonse&s ld ,anderruDtuged LDéfietonvemt s,c dCugedJco paecoi1né Meviconmer#8217;ane cffouereeamturr selewuracrtepruiase#raatsonnelent.,. L énmdveréaonnet#u dosnntreue cfvingtaind deCinsus SLcsnijeébsp;;:C& éme lsi eson (&angoisadntlo#Dtuged p>

WSMî s dCrecstruDtugedJt paniffétet Il syupteudpemgsscin Ls ttc=foip, i aclé tsscmméedear ontre due cainstrease#raa éjticc.ceaa8217;Éilleasstcmains listlnc tdNantéi r re erefuséeelar ontre du.L dCugedersnph/tqiale8217;ÉOétt olye uàJànn dbu daucc ejr r-làcmai dt payeiartidts lutôtredt scsnloce xe#ueu lai dursjticc.ceéts e mspa oni ent., déssetsaàredus,eesa#8217;ioulsetu iveedJciamraés eleuaisnee#ueu ssageeeuecyclonedCht tl,s Ildt payetwurntsmheza# pdàaCabaeft. Peunrêe lépouraauiue cé onsetqiall,eharceuaaél#8217;antreessctéléphonce tss Ildt paenolront13ïeue (,eeséllerlrlcuusctéléphoneoic ldsneeéps erdL qc onse&treesld àl#v,veau, i arén uaetsdeanderrauCdonse&dceu iàpcomdeul&e c=eue (uvit /ndepaqdeejoieer,. Lpsetreessc#uCdonse&sdCiultipl sntéenrsraat doru Carssciat d LOrsnmtnaîte éni cepesa#8217;iohiltor ddq pdulnéjàvé tsexposé ads leaqdsrnste17v#raa éseconneàeeléifvddàea ée nteitituénneà qmcft o p>

WSQuesfa -lleompassde lcduiot sceuabsp;: ?sbr> s1) Qslsl/aeecstruDtdonse&t pamnda1o /édàdelagravpseeifficultéao#ddnmhénec deeogie t. a) Pwurq oianeédunse&dasrsiaio #8217;ianeébu daucqiale pamnéstsrsotégéà qmcire usnnesc#qsnrsel tnrsRnon-asvitéqmcx ra p-lle enerea Rnésvsont s#8217;iou sr1n#8217;ioubordrs lde c=gal rieeeuelocel #8217;ianeéunen cstnbuele ,detsnési cepssdn#8217;Éépiase#raatsonnelent., d8217;ianeéeeltaurt tJrwurarén uaqaluneamsipal,pi eson (&d8217;ianeéugedbsp;: ?LIldt painrn nt nrrevtduàlepoemplu#qsnct é ao#ddféd p>

WSb) Pwurq oiacrteprsimsipal,pnmdveréaonnetx ra p-la tcuréqvingtCinsus lqii eea éeépteiiemt oiyllabi&#eoàea éi eson (&dDtugedJ#8217;avuurt pacuréqq a#8217;ÉOnspacer#8217;ane cfs nteddbsp;: ?p>

WSc) Pwurq oia cé onsetqialn onlesa pempreodiamraaonnet#8217;avupilpt#8217;iohrlntudel#8217;antreesdue cauged,l#8217;avtsppilptneéumivuroche dDtuged,e 8217;iou ra p-lletreesé,u c=seraie-.ceaa8217;Éie c=seul foiptc ejr r-làbsp;: ?p>

WSd) Com sntéexp ii ervqieledC onsetf slongtempluprêdPuctttdat tqns lus dvéhicul stcmarche #8217;iaurrivéuidDtuged,eai ccl#8217;avtspprrn vqielrwurarén uaqaluneami eson (&dDtugedPucusonvrssciat ,nigeangoisadntlofûp-la bsp;: ?p>

WSe) Pwurq oianear pa motersds leaqdvéhicul epacdus,req ndeuc ejr r-làc terslai dursjticc.ceéts mspa oni ent., retu&#s vieu, don reanlsgai eeeis&#eo#8217;iaêe dosnte uàbsp;: ?p>

WSf)Lcs q,&ursru Cl aa8217;Éiéts m-la tcrteprnmdveréaonnetqial#lupveva nrêe léstetdeuep qmcire usbsp;: ?p>

WSg)IEol ePmrdli 09 Juleer20etsedPjeuta141 Juleer20153,,alqsreéunnne/0q pdt doeudlreudssdn#8217;Éépiase#raatsonnelent., dudeeltaurt tJ#8217;ÉOéttnéeàe émi-jwurnte,lewurq oiaelsd-ildoeeltéle,,horscr20#8217;avt dorlptpnéstsà assde lcl rutdchsnésbree bsp;: ?L dseeiffétet doeecstsc#uCdonse&es ltennqtentdnmpmlpq la’ianeéq pdaa oni ensr vesdi ts eeltaurt tse#raa écapéblse p>

WSh) Mî s dCve redta212 Juleer20153,,aursdq oialqc onse&q pdultv,jr rnpé tssivurompdoàvsén uaqae xenipplicaonnesc#DtugedJ-tqialn ree -p-lleéts msobsédéarsue 8217;iaidéevqieledmcx iiqttésaducur er lexursif éu ra t., r mmeée dta cssscin es u&e r onse&ar u&qi8217;Éilus (utsut lleai neécepssdn#dCugedeaf dpi eeerCeulnrerarevnne.apssdnsameecsan (u8217;1;dn8217;avupilptdaie beefceir l#dCugedebrn vqi8217;Éii ar ntenûpai eeeru i-cspss ltennqtâto eptsoàlhirptfoiptànn dbu daubsp;: ?LPwurq oianea#8217;Éép-p-llerlpttreeséeerCsi r-làcbrn vqi8217;Éii ar nûtruDtugedJunl#umérosnippostsncntenuceuCgai eepee icbsp;: ?Li)LPwurq oianea#8217;Éép-p-lletreeséeqieledCavmdta143 Juleer20153,=rselelqsndixïeue (,eAMbsp;: ?LEtaursdq oialqc onse&a-p-lleéttssivinqiaecaaueurnste#8217;antreesdueru CiursdNrsel tnrsRaf dpesantelirmrl&l fmontruDtugedbsp;: ?LOuosnntreupwurq oianeae8217;est p-llejamai ddéplacéerwuraaeeraair lcom sntéclé ts dCugedJcurt tJ#rsReue (,euqeson hospéblsiéaonnetétt /ndlsnéaq nsd saolssvjr rnpq pdaaécèdt s,cil yupteude c=oele rnmmplici tsstereledCugedJtpalqc onsebsp;: ?p>

WSj) Com sntéompassde lca éeépteiie#uCdonse&ausugedJMtés/vqiall8217;avupnrnt nt nrreasi eur u&e rfa paqi8217;Éii vmcnteuirptedCugedJluneameéunnne aucnmursc#qea qlla t#dCugedeané Memrlmcné. L éeépteiie#iaeogie tutsmbaitbsp;;:C«nbsp;?LCel#8217;avtsppilptoaséiu&#esceuaas8217;avtsppilpsé LJtut8217;avtxp ii eraipru Cnrtdl bsp;:»MpDlpq lau8217;6;ceuab217;avse8217;esagil-llbsp;: ?L dCfaaél#8217;anêe lémrlmcnésoàlceu iàeecnteuirreledCugedJluneameéunnnebsp;: ?LTt scmpptgvfaaé,cil #8217;avaejamai drrn vtxp ii é éi intee t.p>

WSk) Com sntéompassde lcégal nt., q eélqc onse&a mspaéféttsmndtwurndue csn mmtre t dse#raMadrmlpJueiuet#lol8217;iaIMEDvqiall pdulreasohlddu8217;anêe lé1a#8217;ioorigind deCl fmontruDtugedarsue césipal,pfaaél#ee 8217;iauvo lcoduirpt1ac tepreeunnne où i aclé tsexposédultv,é lesoré ao#ddssscin leetsdeamenactsbsp;;:? l vmcpaéféttstwurndue énmdveréaonnetirle#aPi eson (&dqsnmatéi rlao#ddbu daucqiraMadrmlpi va paeci érrc&ursdn#estnbuele cbrn vqielMadrmlpJueiuetadm tepri 8217;avta téts mssiedérangéuprsue fmontruDtugeda’Éiie cuarénteuirptedCdonse&ausnmursc#qecrteprnmdveréaonne.p>

WS2) Mî s auCdeaàsdurfa paqilsl/aeecstruDtdonse& c=oid dorlpteogie tmt s,certaoaséséléme tse#rason eecstrntelirmrste#8217;antru amssrnstssdudeecstruDtugedJt, q pdst docofe tr dptànn dpempreoeecstruqmcft o p>

WSa) Pa lexepal,l dCdonse&adm tu&#esc8217;avtsppu iàqialaNroimsa u&i p-me lse8217;ioieitirifvdd 8217;antreesdue caugedids lea emi-jwurnteruDtueuta141 Juleer20153,. Fa paqilsl/augedirapior,,eàets lecr xeqialneàeeçuason eecstdLCeeft olurearem sntéanodin i u Ce lébrn va Rlogie tuqilsl/augediéts mspavso réedear ontre dueddmcx iiqttésax iiuc&euPnijeé&uDtroohèstpusmnr tesnsrnele#raa éaelaies ltenent Miie c LDrsru Cl dCugedeanaéfléchi cclndtineueuta141 juleer20153,&qi8217;Éii vu iàfallaienr esr1nàdsneeéps eruvit /ndepsdPdécentrs#8217;iou sr1nàda éeéunnne. Sne acompane ao, l (Beesrns)neopft olunlréirngnageaéloquut Ics q,&ru CnqilsBeesrns,e dCugedJan SWilnr1nMtés/vr20mîtredàSamu enddistinrntelirmrsteecoi1né Mesollici tCarsueugedersnph/tursdn#euranteiilenàdsecoi1ns8217;Éii véts mssagse#8217;iou sr1nàdc tepreéunnne.aJgedJMtés/vcléiqsrusCuvilunégaif ,Jmai dMeenddistinr#8217;avyavoyt pailpt 8217;ioienmdvédnnet.aJgedJrsnph/tuataogee 8217;iauvi dursMeenddistinric ldugedJMtés/vqial c=seprct on dlru Cnsrle#aPi eson (. Pwurq oia céugedersnph/tu ra p-llecherhlddepanbttduàlesanteiilesd qee lsaiqsrsrle#aPi eson (bsp;;:? C8217;est paqi8217;Éii vu iàadeffectnvemt saé tsceandeén#8217;iou sr1nr ontre dueddmcx iiqttés. Not leeneu ssa s,cq eéugedersnph/tneavoyt paurcuntienmdvédnnet àec eqi8217;Éii ar ontre do#pseuvoceise#raa éaelaies ltenent Miie c LMai dqti eea éssscin emtrea sretsqi8217;Éinle pdaampsnaaél#eer ontre due cainstrease#raa éjticc.ceecaauu amsssel tnalttésaducur er lexursif , i acll tgét1a#8217;ioiedéptdat cludueur er ljutaciir ddq pdaveva nre orscêe lémierrenacdus,bsp;;:C&llerssden#qsnct nultsdn l.pQ ndeu Dc onsetft srmt é rea éssscin eursdndr ddm tugeda&#eledmcx i amsctttdat s,c dCugedJslucramp tnrvcasodJpo er letsriamrmlptimie nt nri eeerCsi àeaueu lai dursjticc.c. Mî s dC onsetindesor, i actttdaqns lus dvéhicul stcmarche, i ac tgédieschauff, l nigeage tse#rasurssaéd,&llerssdenlesantmmn desd qe#8217;iooééiaénne p>

WSb) U ure léfaieneopereanec deanodinJmai drévélao, ldL qc onse&ntelirmruqilsl/ave redta212 Juleer20153,e dCugedJan Srsg lJrsnph/Jt pavtduàànn dbu dauc eptsoàlhirptfoip.L dCugedersnph/tntelirmrucrteprucir1on (&ds lus deecstre xeugedssenrnrdlaSitsesVller20Bsg lJOdLSurroims Ild#euratxp ii eneopore léqi8217;Éii vu iàadé tsceandeén#errevtdirpssdnsameecsan (, Pwuracraair d,e dC onsetssde ée esord tnnc tcabrévirifvddl,pnmdvoqti eneopug,un deursdne eiègsespecse c ePmrdli 16 Juleer20153,. IldditaausugedJSitsesVlleqi8217;Éii ar ntena srets mootes,esa pemftrddJntena ssa cludueeoi séeéle chaitrn vetruqmcrctcéde (,eeéle eCl aae véts msst aomeiilenrsuerapior, àea éft iabiltté depoele recon (.p dCugedeSitsesVlleeép ii eeq 8217;Éii aspreéfétaieneontreupusmneiilenqi8217;Éii vu iàava nrdlsnéaaudot sdébuél#ee 8217;iaufair d LDgvfaaé,causnmursc#qecrt&nntrreiuetac ld#pCugedeSitsesVll, i ac tlirmruecoi1né Meru CiursdNfoiptauCbu dauceuCdonse0ewurar ti dua#8217;ioord tnnc tcn vqieson (.pcs qcllecvrslscusonvànn Doaiqsrq 8217;Éii asiégeraiencePmrdli-là,JsdPdéior,,raaél#ee 8217;iaufair ddttéiartialtcaaueCanadmtac lds éaelaiesdLCrtaoasésu iàava sntéomeiileeéndepaqdair d ait /nmrdlidLA orscursdq oialqc onse’ava-p-llerlptéeçue pCugedec ejr r-làbsp;: ? Pwurq oiaàscha&#s vis cepi arén ua paqi8217;Éii v#8217;avéts mspaluprêd àpaqdeeceir bsp;;:? C ttc=frml eruord tnnc tc#8217;avéts mspalueontreutedigé,pouemnr igé,bsp;: ? Pwurq oiase&q pttt taleétnbuele c dCugedea-p-llettduàànêe léjrngnable&ursdn#es onse&jtiqi8217;Éilui pdrssnp1ne t#umérosncntenuceuCgai eepee icaqi8217;Éii vulit=et olewuratreesduesneeéps erbsp;: ? Pwurq oialqc onse’ava-p-lletreeséeqieledCavmdta1ndtinbsp;: ?LEtaie-.cea uceai 8217;ÉilucePmont nr#8217;iaord tnnc tcéts mspaêtebsp;: ?LEtaursdq oia#8217;ava-p-llerlptdaie beefde lcvis cepausugedJ1a#8217;iohôpéblsbsp;: ?La uceai 8217;Éii acroyt paxtjceamont n-làcaa8217;Éilleéts laeuotroased8217;anêe lébernéprsueneéugeddq pdfengnarpte c=maldeieeeiplom oni enewuraévie eàdepsiégernmrdlibsp;: ? Pwurq oiads lea esi réeae8217;esinqiaéts m-lenàdntelirmrl&l fmontruDtugedbsp;: ?LP uceai 8217;Éii aéts mssurroimprsueneérssar xeiiuc&eraa éneit dbsp;: ?p>

WSAutt /ndepqieson (sca xqlla saa éseul/aeepteiiet paqieélqc onse&a mrmlntab int nrnt ni. Pwurq oiaa-p-lledûrnt ni bsp;;:? Qslsvrsla p-llecahe bsp;;:? cs qclle#8217;avtsppilptlc=seulnàdnt ni ,e Sainstrease#raa éjticc.cecusonvarnt ni. Issavspsayéc#8217;Anait cdua#8217;ioargunt nrfarfelupn onle ,aae vneameéunnne aurt paiu&septtirc,smî s dCfa paqi8217;Éioe&a msci tssneenomdnmpmlpiarticipantnàdc tepreéunnnesaigncfre ot saipal,nt nri 8217;Éii v#8217;avyaapilpteudepreéunnnesdudot dLCra éaurt paiu&êe lévraipns luneéure lémtrdd p>

WSEndeffet,e Sainstreaseclcoflirméass leaqdvrslorc&esvt tal énmmiqsonsrvqi8217;Éilley tva ple c=uaisneear u&qiquc tepreéunnne s laeudlreu. Pwurai p,atechnicesnudueeoi s, i aéts mspussibleRursdn#esugediderrevtdirpssdnsameecsan (. Com sntbsp;: ?p>

WSLpseuvoceise#raa éaelaies ltenent Miie car ti dua sntéa, l&urees LL rnmmiqsoir dd àlivenrnlent., cuson LI Dvdmsscir1a sntée esreqit aauCdonse&i pd ,andet /ne eiègsespecse cursdnudoefugeédL qc onse&dmsscir1a tée esord tnnc tcabrévirifvddm tugeda&#i&assde i/ne eiègsespecse celeuaisnee#raa évacngcrljutaciir d IEolaor,gl ildaouraltcaefde lce c=ure léeecsan (. Eolc8217;avtsppexaco, sntéotuqilsl/augedirsnph/tntelidJànn Docolleg#ssvjgedss Ild# iàadé tsceandeénceuaaepprrn vursru C l vmcnteiultéd#pCugedeSitsesVllcursdnêe lénmeiileeénsrle#aPft iabiltté depoele recon (.pCra é#8217;avimplce espalueontreui ee Sainstreasea paé tsrsennqtnàdc tepreéunnne.asbr> sCertdat tl d saolssveecstscantéi r rsnàda éeéunnnel dCugedeanntfli sàets len Docoflint Msaqieélqc onse&ava plvrslu qi8217;Éii ar ontre âte Sainstrease#raa éjticc.c.pC8217;est pa.ceaa8217;Éilleasntfli sàesneeéps erdsàeugedJMtés/dsàeMeenddistin.pC8217;est pa.ceaa8217;Éilleasntfli saès lue éeéunnne àecr xea xqllaqcllecsract ééa avmésavtdql d IAusugedJMtés/vllediamraebsp;;:C«nbsp;?LSiéu8217;iauvaqsrsriviCtt aomeiile, jdJ#8217;avuurt sejamai dvso yéctaio #8217;iahulaiisdn l.bsp;:»MpAaMadrmlpJueiuet#lol8217;iaIMEDvqial#lupveva nrcror ddn Dotreia sai ac tliebsp;;:C«nbsp;?LCqsngnésam8217;avt domrlmcné. SeulnceéLisadeuàadé tsetdereeec llmoi.bsp;:»MpQ ndeuMadrmlpJueiuetindesorbsp;;:C«nbsp;?LEte Sainstreasbsp;: ?bsp;:»Mp#171;nbsp;?LIl #8217;avupilpté tscusonvarroga., q eélqcltenent M,smî s iltindesot olewuralivevul&e c=soluénneàjuridi&#eoacceptllmsbsp;:»Mprén u-i SAdsneeéps eruinqiaètetqiale8217;ÉOenqiaertbsp;;:C«nbsp;?LNeame&daspilptaa8217;Éipès lui eeersngnésat8217;ava sntécusonvmrlmcné,atu pacangéeec llr xbsp;: ?bsp;:»MpEt&i pd ,vsén uaqbsp;;:C«nbsp;?LI v#8217;avyaava pariuetàacanger,ru8217;iauiaaipal,nt nruataogéeneérrup ec llr x bsp;:»Mp>

WSLSainstrease#raa éjticc.ceMdàan SRnéesSanon/aéts msbeler20bn csutenenéeàe éeéunnne.sbr> sLs ltenent Me#raa éRépee ii eecusonvarnt ni. Issaflirmrlaa8217;Éillr#8217;avuva par paàmpemevul&qi8217;Éii v#8217;avéts mspaluàe éeéunnneJmai dqt8217;Éii ar vtdtrpt1ac xeqialaflirma sntéa,ocofe tr dndepaqdpemevul.pCra élaisstsnipposul&qi8217;Éii véts mslàcmai dqi8217;Éii véts mslacmai dqiedot sl JmtrddJptéeçue 8217;iaord dndepmenerc&tason sijeé,retsqi8217;Éioaséiupsel tnrv#8217;avullaienro er lpemevul&qi8217;Éii véts laeffectnvemt saphysni ent., reennqtnàdc tepreeunnne p>

WSOe&sdCrtreesld q nsd saolsscmpptg-ye uàJ qmcx rtonnescudoeureesdava paé tsfa paqit taauscmppont nt nruDinnstrease#raa éjticc.ceaaidn8217;avupilptdaie beinformul&leédr tes, l&générlse#raa éPrlicdJqi8217;Éillei va pasraair ddmcompanelerprsue csn moot bllmsse#ra#8217;ÉOUSPN,a#8217;ÉOUSGPN,ea éCAT TEAM,r car oot bllmsv#raa ésurssaéddltenent Miie c LI v#ee 8217;iaupilptfaaé,cspsayt /ndepso Ce ir ddersn moot bllmssedétent, lse#raprecsl erpainformaonnescqit taauscaltderidueddmcdéplaceme tse#ueutenent Me#raa éRépee ii e sbr> sPa lexepal,l u(&dqsnréirns nract é eq eélqcutdqcd08 Juleer20153,,esetssde t /nàcrt-au-Prince, ,l#dCugedeané Mestoppénsrle#aPrsué snaonnelrlu# 1dsàehaué uc&esa#8217;ioArcaha s,prsueneqdvéhicul ot se eroas,prick-up depcoicduc&blanchc LI vs8217;avtspparrêtéuneépeudru Cnlo dpi eee8217;ioure lévéhicul qialn urstonnena tads lea edr tesnnesdudNordrmailes u&e rnôté depl énircultonnetxiet tarselelqdSuddLAaséi,e Ssndr xevéhicul mssluliveva sntés u&e rnôté depl énircultonnetxiet tarselelqdSuddLAor,gl l ot se eroas depcoicduc&blanchc qialn urstonnena tarselelqdNordrapfaaél#emieiiuc&rt&nsnrrevtduàe8217;esarrêtseCugs,,eàenôté duévéhicul uDtuged LLeschauff, lpfaaélbaisstrusaopurtrèrqa#oi sddttée8217;esamsscirdm tugeda&#i&apfaaélbaisstrusaopurtrèrqagahe bsp;;:C«nbsp;?LTuam8217;avempte se#radormir,Ma sévraibsp;: ?bsp;:»MpUnprnmdveréaonnete8217;ÉOensrivit aucnmursc#qea qlla tdraaéi r erpamenactsan paé tspemféré,sJ1a#8217;ioégade uDtuged LIssarr ecfi eeerCchauff, lpané Meent Mili snmpmlpétt taleéutenent Mecrtuley/ei p-me l Il séts laausroet taetàava nrdr xeage tse#raprlicdJeopuniformue#ra#8217;ÉOUSGPN&ta#8217;iaurrrèrq Ls8217;iaused8217;anr xeaaphotogeurhiée pserivisnoccupa tse#uevéhicul uDtuged LAès lue éaéi rt 8217;ioieje (,eesédeamenacts,eaqdvéhicul e payeiartidrselelqdSud,smî s dCugedJtberluéanearensa paqi8217;Éiàa avmurt l vmcnteli sàesneeaget e#rasurssaéddJohnnyeeséàsst aomusas Beesrnslaa8217;ÉillDvéts e mss u&e rurnste#evnturil.pCrejr r-là,l#dCugedeqialnrdinir dnt., cllaienànn dbu daucse&ionget tal éRsué sNeevu,Mau s dCBoicdvade LaSanlieamets#8217;ioAvtdue Hurry TruandJjtiqi8217;Éiaueu lai dursjticc.caausBicent nir d,ea uDtempru é rea énaonnelrlu# 1Jjtiqi8217;Éiaueneneas-vaies éviet taaaséiul éRsué sNeevuMau sq eélqcchauff, lp#uevéhicul usa#8217;ioArcaha svu iàava nrditbsp;;:C«nbsp;?LJeam8217;avinformucduiot setemcdéplaceme ts, depoes ho tr dp,detsdeatemcdémêlés. Tuafert semir xe#rarégsduec teprufair dnx lru Cnvt,,eur lq eém éaelaies yerivevqeelsCcrl l ITua#luea spilptaaeéu8217;iauim Jmtr éps erretsm(,eenfa tsbsp;: ?bsp;:»Msbr> sAor,gl cr q pdssssontruquc teprhypothéoni enr ontre d,lc8217;avtsppcda&#i&apé tscidoru Catôébsp;;:C& éaelaies ltenent Miie caéts lavrain reeab int nria,uquéu IAuson,aleéutenent Mea-p-lleroimsa u&i p-me ls#rarégsduec teprufair dnqiall8217;avempte aaél#eedormir. Tv,tra#8217;ÉOéqispluuquc xeqialéts e ms#ddb leetsloye xenrvics, lsepné Memobiltté,lrwurarégsduec teprufair dnx lru Cnvt,,.pC8217;est pacusonvrwurq oialqcutenent Me#lupveva nrnippor,ec&eraa isstru Sainstrease#raa éjticc.ceoééier ot saeus. Lpseeirseleréirngnage ereouel eisca xeubordseeuecrlneepaelaMdàLisadeuàntelirmrste’ianeénnre 2 impsnt /ndepvéhicul msgénérlsent nrfa iaio iartie0uDtcmrtègse#raa éptenent cluéts lacteitsdééecmurstonne depatsonnelent., d saolssvrsuaedsc#uecrlneep.pUnprpauv léfepmlpq isgénérlsent nroid dost aompmlucead saolssvrsuaedsc#ieneopeer lciocmbréedix-hirp.pcs qcpr d,ee c=polémii eecrsriviCe c=phrlse urearem sntéanodinee#ueutenent Meq isd=et obsp;;:C«nbsp;?LJea#luea spilptsialqcrsmcrerainstreaseéts mspaennqt,snmpmlpc8217;avtsppot spsèsd qee lsbu dauxdausmnstreèrqa#qea éret ilic on (.pMoi, jdJ#8217;avyeéts spilp.bsp;:»MpPwurq oiacru iàqialaNd paqi8217;Éii vr vtdtrptauxdaui ams(n Doaccusao, ls)e#raprmevul&qi8217;Éii véts lautenenéeàe éeéunnneea-p-llettduàànfir ddertepreemsee t. Seraie-.cerwuranur dnx lrsmcrerainstreaseou&sepdedoit bsp;;:? Il #8217;avuurt pailptbeauisndepsdPdedoit éiul é moot blliltté depa ésssevqencntmbqae xeaccusao, ls. Sûrint n, i aéts msinqiaecaqi8217;Éii vpveva nrêe lésurroimp tu&#es#raa ésor,,ei vvouers msimp ii ervlqcltecrerainstreaseàa avplace. Il #8217;avéts mspalutotlrl sntéottaoaspi eee fmontruDtugedarouraltcaent rier n Doagisstme tseursdn#esirns nsuootess.pUnvuroche dDtltecrerainstrease ée pteduàmc pJbt deusdueutenent Meuet#iamraan20#8217;avêe lép parivp cetaoaspi eeeqcltecrerainstreaseuurt pa#8217;iohrlntudel#8217;anulit=etc&lsscmrtègse#ueutenent M.LTt sceai,JndCfa pa8217;1;euu-deaindedoeecstsc#uCuged-fi eeetelirmrl&l futenencusdueutenent Meàdc tepreéunnne.aSo Ce ir dd csn moot bllmsse#ra# ésurssaédd#ueu lai dnaonnelr eé&uDtroenent Me#raa éRépee ii eecupqieson (lent., dpcl énmmiqsonsrvn8217;avup’ianeéseulnrbjeesnfbsp;;:C&burrrcaddue csnaco, lselssvru Cnvulnérlbleseursdn#es empte c&eraa isstrufuie eàdepainformaonnescprecsl erpart&nmbur ssa s,sdLcs s dCcriilpiarfa pa#8217;avtxesoravraint nria p>

WSQut taausltecrerainstreas, i aclciamraééot sdesgo&esvt tal énmmiqsonsrvqi8217;Éille#8217;avuva pajamai dvudlamnangcrr#eer ontre due cauged LCra éaurt paiu&êe lévrai Vcs qcot jr rnpns luneéure lémtrdd p>

WSCom sntéexp ii e-p-lle dCfa paqilaMrbsp;;:LesrvCh esrsea paé tsrtreesée#eeWashingtneear u&eneaspefde lce c=iqsonsrv#ddb leofficeshdeot /nàcpseluaer1nMrbsp;;:F oreitsl&q 8217;Éii vuaisststsmbtrusaoplitsec,&q 8217;Éii vuaar ti daetàabvnr tnrv 8217;iaufair d LDgvt taleérefusaelaMrbsp;;:F oreitsl,esa pemcrèrqnyleconne&apé tsc8217;antreesdue caltecrerainstreaseursdn#esieée dtse&nteteco ec llMrbsp;;:F oreitsldL qcutecrerainstrease éoffrtéeàeMrbsp;;:F oreitsl&#ee 8217;iaurgsntéenrudJpostprta#8217;iaextéi r rudueu ys.pF oreitsl&refusecot jr rnpenrLésrvCh esrset pnpasti p>

WSPwurq oialqcutecrerainstrease va p-llecrudb ndeps8217;avimplce erRns luc teprufair d qii eellea&i p-me ls#iamraééàe énmmiqsonsrvqi8217;Éilleava nrniiviC 8217;iaufair ddnmpmlpot scieonse&n va isadnttlc=suisnàaa éjticc.ce#rasuvi bsp;;:? cs qcpwurq oiaa-p-lleéttssivévasifcqit taànn doccupasnnesdudtemplucdPjeuta141 Juleer20153,bsp;;:? Siutsué s#8217;ÉOéqispluuqva pasramtre due oyelddttéeolidir dd àlroenent Meewurq oiaec=seraie-i aso Ce irt àec epetaél#eer laelaiilsbsp;: ?LPwurq oiaausonvava p-lleéiupsuc&eraa énmmiqsonsrvqi8217;Éillea&euPnraair ddmcompanelerpdepsix&dqsnmbre ,sd qeelsCcrlneepbsp;: ?LPwurq oian8217;ava-p-llejamai dso miluc teprcopie&uDtroohès-vulbe cdummneiilendqsnmnstreasse#ra# éveia vqiall pdulé tsriamrméJt, q pdaurt paiercsdnàe énmmiqsonsrvdqdvércfreralamssrnstssàe 8217;iaord dnduejr rJtpalqurar ltonnetxc llo teprépnee eruvfair dd#raprmhèstntre do# éaelaies ltenent Miie cbsp;: ?L àueontre, t aompassdepi eeeqcltecrerainstreaseon/aru Cnnee# mspalu# évésaédds u&e rsijeé p>

LLbrong class="spip">JIConclusnnesstrong>&/p>

WSTt scmpptgvfaaé,cil s8217;avtsppavéréqq a# énmmiqsonsrsé8217;avtsppyerivevéuidgvt tae cffor,ecscirddeamenl tg,sdLcs s,cil #8217;avyaapilptdcffor,ecscirdipassdlble,cil #8217;avyaapquep qmcrea oégiepaintreemprié,s. br> sL énmmiqsonsrsptfaaél#eeelsCmir xeepaaleéusonvànperctc& csn mmpastsc#qerefusaesédeamenl tg,seqialéts e msé igésidgvt taie c LEd Dcaapuée nteititutc& csnft o nànèsicrc&ersRnore , xeiéirngnage ereouel eisc#qsnrsel tnrsRq iàava snté enerea8217;iaoe igsonne elac tlie1nàdc teprnmmiqsonsrscdJqi8217;Éila sasava sntét, q pdc8217;antrsèsdla sarouraltsntéaider&taair ddjxaieil&l flucrèrqnssdn#es nircostlnc tdNq pdt doedtwuréee fmontruDtugedaan Srsg lJrsnph/, ndohlrg,upesa#8217;ioufair d oppsnt /npusmnr tesnsrnelelescieonse&Enold F oreitsl,r#8217;ane cfèsicbsp;: ;mets#8217;ioéps erretsedPfildodueutenent Me#raa éRépee ii e,e#8217;antru a iart,&ursdn#es ft o nqitlili ao#ddnmrruponnedetsd8217;anesurrsonne elafonconnetqiallqurait doeeasohlds IL énmmiqsonsrspt#iaoenrntbsp;;:Cp>

WSa) dCugedern Srsg lJrsnph/, agisadntte(utsué siedéptdat cl,vcléiqsrlDc02 Juleer20153,rusCugednt., vit /ndr d-eoi sRns luc teprufair d,e ,aae vugednt., metrenacdus,ul é moot blliltté d8217;ianeécetaoaspnnre 2 decgai esénmmiqsr#ra#8217;ÉOEttttdo taleéutecrerainstreas. br> sb) C ttc=eecsan (uclébai lée psebassse#ra# éfor,ecscirddeacmncusonsrsstcmetttnéeàeduàlesavla éttéao#8217;iaudJpo er lx iiqttir ddtténmrrmppu. br> sc) Tv,éllssvjr , lsevedaté led s#8217;ÉOéqisplun paé tsmobilttésecxcffiesc#8217;ÉOent rier x lru Cnvt,,e 8217;iaufair ddna lea tava ttntm sncéeàmgnelerpeopepal, rJtpal8217;esaminstrea on (uava ttntm sncéeàmrsedaseenactedililtté. br> sd)IL épemcrèrqnétspupesa#8217;iooffrnsfvdd ,al8217;esaminstrea on (uammneitreéeàmobttirc&euoplitgnanpaqi8217;Éii vr tr ddeaoplitsecnigeaeceptdd csnutebe desdqi8217;Éinle pdaampsnaaé. br> se)LDgvt tal8217;ÉOée cd#rapareia offrnsfvd,aleéuo er lé8217;avtsppyerwurntsrselelqdugedei p-me l,àabvnr tnt tal émanrèrqnbâtnedetsna ot,,eur ladoptul&e c=rulctce tdipaé ial uDtSicsroeo,eaildugbeo,eaildaam a on (qdvrluetep.L dCugededi sédon rfir dderpquepve sl Jur er lexursif . br> sf)LDgccssscin leetsm(nactsaduiot é lesoré aon paé tsexercé,sJssdn#dCugedersnph/tursdnqi8217;Éii vr vnne.apssdnsameecsan (. br> sg)Ls8217;iaexpsetislceuecrlneepaLisadeuàadé tsmierràmpemf olewurauteparele#aPft, (ourfarct)ajuridi&#eo#ueutojesédeabaaieo(lent., dpcl éjticc.ceecaduiot é le saieitituénnedoeepee icainds. br> sh)L qc onse&#ueisbuele cdpcrsmcrèrqnIstlnc tcdpcrt-au-Prince, aenrvicd#rapivotaneneae caueutojesédeaa éptenent clue(uiarticipantnàdot é le santmbinrpart&x i amsccé led sdélaonnesc#gvt tanteuirrelàdc teprfrml erumnda1o /asnnesdudugedeac ld#pseru C haué lex iiqttésaexursifvdsc#ueu ys. br> si) dCueuta141 Juleer20153,,aneameéunnne é8217;avttettdueupusmrlneepaelaMdàGrydéLisadeudL qc onse&MdàRaymtrd&an ichl amcnteuirpte p-me lsedCugedJan Srsg lJrsnph/Jàdc tepreéunnne. br> sj)IAusnmursc#qecrtepreéunnnel dCugedersnph/tuné Mesoucsdnàe 8217;ioietnésbccssscin leetsm(nactsaursdn#espor,ec&àeaeceptdrs#8217;ior eridne eiègsespecse caf dpesarevtdirpssdnlameecsan (u#ue02 Juleer20153,. br> sk) N8217;esaya dorlptexaqdnéplamthes,eesa#8217;iommpoiso(lent., q p,ame lsonvie caéts lapivevéu,=seraieneifficilelàdcircostcrr ddds lea8217;ianspaceretsedPtempl,a# énmmiqsonsrsaaeci ise énmdviconnetqidd csnm(nactsaetcssscin let doeudgoas depcdus,eesa#aavie&d8217;ianeéuged ho(lt amai dfragils. br> sl)Ls8217;iahéirrragiecire a-eanec hymao, iie#iagnostce édJseraien énmdséquutceédr tes,r#8217;ane cffor,,esoucsdsnne àe 8217;ioietnésbccssscin lepsychce tss br> sm) dCugeden8217;esaya dojamai dé tsciagnostce édnmpmlpsouffrt /ndeprctblèm(,emétsbolce tsR(hypsetu/deodJartéi rlle,chypseglycéiqs,detc),e Ssnmédeciesc#qua8217;iaHôpéblssenrnrdlaMevélt docofcluqq a# éts lufor,,etu/deodJartéi rlleacteitsdéesmheza#rapaoid do orsc#qason umindsnne àe#8217;iohôpéblsaéts lapeun-êe lél/aeenultsdr#8217;ane cfhypsetu/deodJire aucrannne.apqialelle-me lsreunrecoi1né Mel/aeenultsdr#8217;ane reassseimmenls. n)IL énmmiqsonsrscofclu/npusfa paqilsl/autenent Me#raa éRépee ii e,eleéutecrerainstreas,e Sainstrease#raa éjticc.c,e dC onset#ueisbuele cdpcrsmcrèrqnIstlnc tcdpcrt-au-Prince, t doot semener ttnéeàe énmmiqsonsrvqi8217;Éiàea énaonnes br> so)IL énmmiqsonsrsinrn nt nrcofclu/nqiedot lecr xeqialnedocofe bueésàe 8217;iaornisatsonne elaa éeéunnnel iarticipéalua éeéunnnel mener àmpempsn&esa# éeéunnneeaucnmursc#qea qlla t#dCugedean Srsg lJrsnph/Jadé tseontusé&jtiqi8217;Éiluerpquepmontre8217;ÉOensrive,eit doàvdesd qgréseeirselee pteillmsse#ra# émontruDtuged. Ildd ntu léstetdeupquepseuln 8217;ioureareialjutaciir ddaurt àvé llmire Ssndrgréseeeé moot blliltté dqcchacuntds lea emontruDtugedaan Srsg lJrsnph/ p>

LLbrong class="spip">JIRECOMMANDATIONSstrong>&/p>

WSFontruquc srcofcluin l,a# énmmiqsonsrse ntmmn de aaebsp;;:Csbr> s1) qc onse&#uetnbuele cdpcrsmcrèrqnIstlnc tcdpcrt-au-Prince, si séliauirptrsuedgvt taleéCneiilenSipéi r r&#uePr er lJutaciir dd(CSPJ)dnmpmlpe rutecrerasuootesRns luc teprufair d vit /nd8217;avêe lélimogéJt, livaééàe éjticc.cehaitrn ncecxcffiesc#queoi s sbr> s2) Ls ltennqterapior, si séliansféttsàdlamnanre 2 demcdéputésecxcffiesculittss br> s3)IL éCanre 2 demcdéputéseassdnuiot é le sadasrsiionnescqiec#queoi secxcffiesc#qbsp;;:Csbr> sa)dCteitstdua#8217;ioimmixsnnesdudmhefr#ra#8217;ÉOEttt, dDtltecreraMnstreaseeé&uDtMnstrease#raa éjticc.ceds lea8217;ianxercicensr veroasedueur er ljutaciir ddcxcffiesc#8217;ÉOobttirc&quep qmceecsan ( dursjticc.casi t., re snc&se&es lpfav, ld br> sb) Diamraec&lsscan coe a iarjuse dfuc srx iiqttésaducur er lexursif éqialnedoot leniée pu liarticipaénne àea éeéunnnesdud41 juleer20153,&aor,gu&#eoa8217;iannqit ac tlirmru pu liarticipaénne effectnve àea diteer ontre d. br> sc) Cteitstdua# étsahisnee#uemhefr#ra#8217;ÉOEtttRq iàava tajuré dqcair d mootes,ua# éCteitituénneàetJ#rsRloiptursa éRépee ii ee br> sd)IMeée dtse&accusaoinle ,emhefr#ra#8217;ÉOEtttRewuracriilpde haué étsahisne. br> s4)L qcutecrerainstreaseete Sainstrease#raa éjticc.casi t., mipa o&accusaoinleets mnvoyéseeeées lpfonconne. br> s5) Ls ltennqterapior, si séliansféttsx lrsee ttd#ueisbuele cc eilcdpcrt-au-Pince, ecaaueCSPJecxcffiesculittsc#queoi s sbr> s6) Ls CSPJesi sé mnforcéprsusbr> sa)d 8217;ioume dent., dpcl éloiàeuC4c eptbre ,01507spor,t tanréasnnesdudCneiilenSipéi r r&#uePr er lJutaciir dbsp;: ; br> sb) aqdvrs,r#8217;ane cfloiàpor,t tanréasnnesd8217;ane cfreauctuse ntre ôléuprsue s CSPJ,ohlrg,érddeacmlltes,uaepaelagérdue csname desdrct on éeCarsue csdCn ls. br> sc) LaNroime ndohlrg,upesa# eedsénneàinrnncrèrqa#csdCn lsaepaTibuele xersue s CSPJ. br> s7) LaNroeparaoinleetsl8217;esamopsnnesd8217;ane cfloiàssdn#es nnqit snr esrmlntar dp. br> s8) LaNroeparaoinleetslqdvrs,r#8217;ane cfloiàs u&e ruarjuse. br> s9)Ls8217;iaeconne&pee ii eesi sémierrenamr vent nrcofeaseGrydéLisadeu0ewurar cel p>

LLFirt àert-au-Prince, ,l#dC06 Juleer20153,,aAn 210,eesa#8217;ioiedéptdat cl. br> sHne.aF t oiptA.Jrsnph/JPtenent M br> sHne.aWdsélerpPolycarpdàRappor,eur br> sHne.aJoelJrsnph/JJohn br> sHne.aStevtd I.senni s br> sHne.aPreraseF t ky Exiu dMere , br> p>

L />p class="spip">LLSwurc bsp;;:C&.php ?article14424&utm"lass="spip">_t é">http://www.als,ussscie.orn/ip">.phpbsp;: ?article14424&utm_swurc =twattr1feed&utm_mdtaum=twattr1pHaïtr-Duvalip1bsp;;:C br> sbr> s LaNviconmerRaymtrd&Daviu duataogee lesouffrt ctsaedeu é lesoulea8217;iaunen csrégnme br> sbr> p>

WSPw-au-Prince, ,l20àavrlen153,p>

WSLaNviconmerbrong class="spip">JIRaymtrd&Daviu strong>&/ecsract éél dCueuta148àavrlen153,,e Ssnnore , snc&eontus,sJssbiqsnrsdet /nl msslptnmoipa(dqcaévrie1nàd eptbre ,01981) ilpsésad saolssvgeômsse#ra#8217;ÉOunen csrégnmeudueeicoao, l brong class="spip">JIan -Clau#r Duvalip1strong>&/,o orsc#DtroohèstcofeaseerCeulnreraewurniiviCewuracriilstntre do#8217;iohuandiéddetadétwurneme tse#lafonds,vclobnrviéa#8217;ÉOugt clue(ulignerbrong class="spip">JIAls,uPssciestrong>&/ p>

LLÂgéeectula nt nr#la57 a l,a#8217;ÉOéet omesoraDaviu drapior,,eecoi1né Mebattu,tàacains lreasi dp,drsdet /nsneea ssagee csutisne. Lpseiultipllstntupptéeçuélt dofietprsue iss eàdes nicatnbc,sJssdnot sasrscorpl,ac tlscie-p-lletée treé p>

LLI asprplitsesdurfa paqilsl/sJsbr dptdudeegnmeunsvu iào dojamai doffrtéelaspussibiltté dqcseaefde lcàe#8217;iohôpébls,smîlgré n Donore , snc&lmsssus,s.IAusnmursc#qe#8217;ÉOunnter1981dsllefupparrêtéu17Nfoiptrt&nmutisnenéerivisnfoip.L#171;nbsp;?LAscha&#s arreatsonne,ru8217;iauiadûdvrmrc&euosang.pC8217;est paàredus,eesac srxrivci tCaq eéu8217;iauiaé tsmndtroastn#8217;iou sr1nmlpcae c&es lea evaies esaBaneepa(Sud-Est),&aor,gu&#eojdJ#8217;avuvaqsrpsel tnrvns luc teprvaiesdLJ8217;iauiailpsé q la&#esnmoipalà-bas vit /nd8217;avêe léarrêté,uligoéddetanteuirpte xeCasrnlesLDgcsnlieasbsp;:»M,JsdPsr vit n, ac ldamentu l,àRaymtrd&Daviu . Ecsutisnel u(&seulnsdauclialn rvaaé,càea éfo q,&ursrecspit Meewuree lsbeauissaphysnologie tsaesédeapliMeewuree lsyeias IL énouraituse lialéts tenrvicee c-dsssouptursa éior,,,eac ld#pserieds,vrsue csdgeômn el.aDaviu déts tefrtméeds luneesceulu caétoi sd, où e c=umpou caéts lattdueupulumés elev#eo#lépseieée dtaucgeômn evdqdvércfrerasialqcmîle irtéeéts laeuoice p>

LLUnvuetaélmao,ss=,rfabrii é v cd#rdoeenenupturstissusnct é nt /ndesrépneg eCl nsvu iàoffrt paurcunespussibiltté dqcs8217;iou s tg,eàdessusnct vsdlblent.,.p>

WSLSaeegnmeuvrsla p air dd#raDaviu du(&"exepal,",La uceai 8217;Éii aava ta isséa#8217;ÉOurmés -te(uta., q eésolda/ndeprcmcrèrqnass="s -tàe#8217;iohôpéblsalaiitir ddewurar joieer,alqcrartiddémocrao,emhréeiuethaïtruet(Pdch),&aor,gudi igéarsue cé éfu., brong class="spip">JISylvio Clau#rstrong>&/ p>

LL#171;nbsp;?LL J13 octoe ,01982,càea éni cepessnm(nactsaexercé,sJrsue csdsbr dptdudeegnme,ru8217;iauiadûdsaué ue csdmursc#qe#8217;ÉOumbasadeu0dudVenezura éausBicent nir d (àmpemximaédd#uebordrdeamec&eraa énapéblse),0ewurar tivevul&e asilc=rulctce t Ls8217;iaumbasadeuuravénézuéeiuet#lol8217;iaépoquepm8217;avupdlsnéapsèsd qe250.00pdlllalsepméricainserwuraaeeraamlpcae c&es leae ereouissa#ueu ysbsp;:»M,Jr ltoraDaviu ,a# étsesorcirdds lea evoix p>

WSEndjanvrera1983, i acltenté,aneams nteddéfo q,&urse8217;ÉOéchapperpeope8217;esintivuirst tdsàe#v,veau, àe#8217;ÉOumbasadeu0dudVenezura . #171;nbsp;?LL8217;iaumbasadeuuram8217;avupmipa o&tenent clususveia éu IUnnmoiparu Cnrtdl,lsi sélc=1trufévrie1n1983, u8217;iauiaroimpa8217;ianxi a(ursdn#esVenezura ),àqialaNduré psèsd qedr xea leetsdemi LJtus iserevtduà[ds leaqds ys] se&jtleer201986,saès lue échucepes an -Clau#r Duvalip1bsp;:»M,Jieeiq a# éviconmerRaymtrd&Daviu p>

WSAee8217;iourdiencusdueueuta148àavrlen153,,eDaviu d futenenéddetacmcrs,eàe énmursc8217;antreescdpcrt-au-Prince, ,aneamlesoraiartieies essdséqiesoraoinls,eeontus,s,ruciuciineisert&nxursifo lus mmtr dp,dperpétoésadurt tal éeicoaouse duvaliéresor, notamnt., d saol éseul/aunnterd,01976 p>

LLFigure tl d saoc teprlesor, cinqejr rnaltsorc [1],aneamdizaind deCiniitir dc [2],apsèsd 8217;ane cfqianzaind d8217;avuvoceisebrong class="spip">JI(enniît Armn d, Emilc=Ca viel Seyntur=Ca viel MaxvCh esma,gl Hrvicu CnAntuisel Hrnri=Carnot,Jrsnph/JVergniaud,sHubrtéeLegrogl Chresoian Nau, SasmaaPreras-Paus,sEdmtrd&Preras-Paus,sAntuise&Preras-Paus,sPreraseVicoorJrsnph/, Rocstrong>&/ecaséiuntenu,rbrong class="spip">JIAntunio Vir xstrong>&/]]detsnéolront70&x i amscieonsesd qedirsellstntue s, [3] aya do isséa#pu lidauce saolssvgeômsse#ueeicoao, l Duvalip1a(dlsnénc&ei é leesa#8217;ioouvuaedL#171;nbsp;?LJIe rutix&euosangbsp;:»M,JTomerII)p>

WSLaNasohlaind x rtonne,sd saolsscad dd àlroohèstes an -Clau#r Duvalip1et pnprév enewura dCueuta125àavrlen153,.sLs 11àavrlen153,,e orptursa éirecént Md x rtee, ,abrong class="spip">JIHrnry Faticcnstrong>&/ecsé tscurtonnenédnmpmlpplitgnanpaaès lubrong class="spip">JIRobrtéeDuval,sAlix&FildoAiméstrong>&/ee, brong class="spip">JINicoleendglorcestrong>&/,ostetdeuseiiuc&àeiiuc&es luc teprufair d. [jep&nmb rcaaès019/04/153,&14:50]p>

WS[1] Lpsejr rnaltsorc ci tCaéts e mbsp;;:C&JIEzéchiescAbellald,sRcnésMidouiel GaslerpRaymtrd,eSitseinistrong>&/ecaséiuntenu,rbrong class="spip">JISas luPrerasstrong>&/ p>

LL[2] Lpseiniitir dc nxursiépa o&1976léts e msbrong class="spip">JIDagobrtéean ,aan SPaus,sMénéss=strong>&/eJIalts=sti>rbrong class="spip">JIAyton,sRcynoldstrong>&/ecaséiuntenu,rbrong class="spip">JIRcnésSajr s,eSiseiag e,eGaslerpSiméne,sV ceystrong>&/ecaséiuntenu,brong class="spip">JI Merctconstrong>&/eJIalts=sti>rbrong class="spip">JIGit tanamostrong>&/ p>

LL[3] Lpsecieonses,adasrarupa o&1976leterapior,tCarsueRaymtrd&Daviu dds lusaPdéiostonne du148àavrlen153,,eéts e ms csdsuiva tsbsp;: : an -Clau#r Alexadereeelts= Blancol MacénasAnibot,JRnéesSBaptesor, Jticcnsenrliand,sRoéesSBnrliand -tedPfildode Jticcnsenrliandbsp;: -, Blanc Paus,sAndré B e -Aîmé,aGérrdlaBlancol an -Clau#r Burcicaut,Jrsnph/JB ignol, Noly Burne,sGilbrtéeCadostcel MuscadcnsCaugs,,,eleéuh emaen csCelaies Sébastrue,sHoracerDaccuile, GuéeotrDaccuile, e rutêe léfrt çaqsrAlbrtéeDs Smeé,rRauh ëleDslva,sAre c&Denrs,eCaddaucan SDéresié,aAmbiviseLDgcravin s, rsg lJDonatrue,sCeotir d Dorneval,sPausJDonn, l,sRoéald&Due mcel Ovezr Duqiesnl,àRamdaucEstrmé,aWils,und Estrmé,ae rutolscieuc&Jenulmé Eugènl,àExdntlocaséiuntenu,rSrvicu CnExdnt s,ePreraseFéqisèas,eMai rtThés lseFéval,sMai rtThés lseGaslerl Hrnri=an ,aMor ony=an ,aKesnllean ,aasnph/JJn ,aThéocllean ,aMaurtcs an -Baptesor, Antunio an -Baptesor, LrciopJue s, Oswald&Jue s, HébrtéeLiautaud,sLelerpLirsetl ChéydéLouisoir tl Gérrdlaichl ,aMilfor,eelts= Joeendlaka,sYvdscMusacl an -Maic Néreats tl Jeci dscPaus,sLrc&Preras-Paus,sPrpiritocaséiuntenu,rD luPréntats tl EddyuPrc.c,ean -LouissRoy,aan SRobrtéeelts= Dérursl,àRaymtrd&Sitse-Louis,sLrc&Sitse-Vll, an -PreraseSitse-Vlleelts= Ti Dyab, SasdeieeThéu Cmtrd,eTonyeThéu Cmtrd,elqcmédecie Weisne Telsnel TénorJAugusor, Antuind Tepalierl an SRifa éVs="sau, Romuu CnVllbrun,ePreraseichl aVébls,sWellingtneeÉlie. br> sbr> p>

L />p class="spip">LLrt-au-Prince, ,aavrlen153, br> sbr> sLebrong class="spip">JI 26 Avrlen1963strong>&/ecu1ndtin,ea evoiouse ltenent Miie caqialamtdtrpt#es nnfa tsrbrong class="spip">JISimoeametsan -Clau#r Duvalip1strong>&/J1a#8217;ioécole,efuppattae édJrsuequae léhmpml d rmés,shrlnllépa o&rset olirs.pUnprluéceps8217;ÉOensrivit aucnmursc#qea qlla tru CiursdNhmpml desa# eerdls essdnnfa tsrDuvalip1efure t tuds IL éyleconne&cofeaseerteprureanec,,etu/trifvdd e kidntreingefuppt riible. U ureescàets le csdmact é lettd#uvaliéresorsefupplancéalua éedeio,&urandet /nàets ledeprcmeer,alq d rmrpart&xnno çanpaqi8217;Éioe&ava nrettentéalua évie&dssdnnfa tsr#uePtenent M821730;. S8217;esinltaurtuneeschs="s àe#8217;iohmpmlpauchs=ade ue ereontre ds,eeo spor,eur d8217;avurmrpl iartisan&ursregnmeuaya dorercsdonsrvdqdtutc. C ttc=uaedLntu trrèrqnétsienei igé,&cofeaseue eofficn eleesa#8217;ioArmés soupçnenéao#ddnmpaloé uecofeaseDuvalip1,eeo sparticulrèrqmsntéa,olreué nt /brong class="spip">JI F t çoipaenniîtstrong>&/,ona lDuvalip1eava nrdiamraééqi8217;Éii véts msl8217;antru uc&esa#8217;ioettentat.( lletreart pra q la&#eln raindsaru Cnrtdlvqi8217;Éille#8217;avse’avéts msriue)pC8217;est pacaséiu&#ests le csdmbre ,sd qea ééaelaies enni s (etsmêmue#ra#8217;ÉOuvocei enni s Armn d, ntupllmsv#rasneeariocm)art&ts le csdmbre ,sd qea ébrong class="spip">JIaelaies Edelieastrong>&/J(nomdddCueundPfill usa#8217;io éps err#ueLreué nt / enni s)enrvnedocrejr r là,letsmêmues tgtempluaès l,éliae ésaetàabvttu . Crtaoaséssbr dptpemf ot., dpcl8217;Éioccain eursdnélimce eàdes rsel tnrsRaf dpesas8217;ÉOempareleeeées ls0bn csdetsd8217;anx i am, nxursie /ndesrgnésaàev#e,aaipal,nt nruatceai 8217;Éii mssluliveve mss u&e urac mce Ecsulusndesrgnésauciuciinélelqdursdnmêmueouemontsoàvdesd aorseiedéfietesad saolssvt riiblespcae otse#laFontrDimanchc, bsaurrup it doarrêtém, bvttu ,&lmssstCarsuebaeers,rmailes uvivvnedoetéottaoasélt dopueiéirngn eàdes événeme ts. br> sbr> p>

L />p h3lass="spip">JI 26 AVRILn1963- 26 AVRILn153,p>h3>p h3lass="spip">JI 50 ANSsth3>p class="spip">LLbrong class="spip">JIPOUR QUE VIVE LA MÉMOIRE DES "DISPARUS",sVICTIMES DE LA DICTATURE, IMMOLÉS CE 26 AVRILn1963l ET POUR CELLE DE TOUS CEUX QUI SONT TOMBÉS VICTIMES DE LA BARBARIE DUVALIÉRISTE, LEURS ENFANTS,ePARENTS ET AMIS,eINVITENT TOUS CEUX QUI LES ONT CONNUS ET TOUS LES PATRIOTES QUI N8217;esONT JAMAIS CESSÉ DE CROIRE ÀLs8217;iaÉTAT DE DROIT, ÀLUNE MESSE, LE VENDREDI 26 AVRILn153,, ENLs8217;iaÉGLISE ST. PIERRE DE PÉTION-VILLE, ÀL5H pm. A LA MEME HEURE, DANS DE NOMBREUSES PAROISSES DU PAYS,eUNE MESSE SERA DITE A LA MÉMOIRE DES VICTIMES.strong>&/sbr> p>

JI.sth3>p class="spip">LLDANS UN GRAND MOUVEMENT DE SOLIDARITÉ, DES MESSES SERONT ÉGALEMENT CÉLÉBRÉES A BRUXELLES,eMADRIDl GENEVE, ROME,ePARIS,eMONTRÉAL, QUÉBEC, NEW YORK, BOSTON, NEW JERSEYl CALIFORNIE,eFLORIDE,ePANAMA,ePORTO RICO, AUX ANTILLES. br> sbr> N8217;esOUBLIONS JAMAIS. br> sbr> p>

L />p class="spip">LLrt-au-Prince, ,adiabre ,01512 br> sbr> p>

WSbrong class="spip">JILasdnuc Hurbonstrong>&/ br> sbr> p>

JICatarongphlépseianesecnigee nteitauctionsth3>p class="spip">LLIley t e c=unomalip,detsnépot scaluneescndtrodiconnetànr esr1n#ddnatarongphlépseianesec,rmaile tc#8217;avtsppilptuatceai 8217;Éineescatarongphlé#8217;avurr ecfi 8217;ane cffoip.LSiutsué scatarongphlénipposuua éeupouse ac ld#pCnmurscnrdinir dàdes nhon Dotueesa#aavie, t adevra ot jr rnpecoi1nr ntenurusCuvantéenrudJapsèsd qea énatarongphl IL édasrartonne soudaind d8217;6audJproche,r#8217;ane oaiqotuee8217;iaudJpanec,otuea éfce brutal u8217;iaudJrapior, antureux, caséiu&#esa8217;ianff uaqnt nr#lats le csdsymbolesavisilmsse#ra#8217;ÉOÉtat821730; it doessdsiouaonnescqiiupsuve msêe lévursesdnmpmlpdes natarongphlC l vseprctuirptd saol écatarongphléunévésaéllmsvyerwurnent., dpcl8217;iaord dd àlmtrddJeopeor,,eqi8217;Éioe&au ssemrsedasets len Dorepè dpthrlntuelsbsp;: ;mneea rle ac lduaisnee#8217;ane cfdascndtinui tsrtdicale ac ldcda&#i&tsppotduàrwuranormal. Odnqi8217;Éiurr ec-p-lleqii ee dobnrvie rettentnvemt saa évie"idrn nceeopHaïtrCuvantéenraès lueluli reeqnt nr#laterasedu142djanvrera1510bsp;: ?LO(uammnpmlpe8217;ioimssscin ei enrn csnrse8217;ÉOéts mspalsééecmecrt&aès l-midréaetidi&#e,retsqi8217;Éiu(&sauppasé tséyleltté v cd#rxtéi tscu-deaàeesac ttc=eatd LLescr rnpnormal,cnrdinir dàdeaa évie&aurt pareasi asiavt,,eqi8217;Éioe’avuurt pailptedPtemplo#lépsnser x l42djanvrer Vcs qcmnpmlpilaneareut&nxesor1n#ddnatarongphlépseianesec,rlley turt pailutôttntm séunétrova lépseianesesd8217;anxenulsonne elaa8217;ÉOévéneme tdetsdon rntm séunéprocessusnls eénégsonne q pdssvnnet àee cfinltallsonne épseianesecnd saol écatarongphl.pC8217;est pa.ceeartdoxeai 8217;Éii acmdvit nr#ladéchiffreraewuraompassder,alq deifficultésàetJ#rsRtâtneneme tse#lal é mnteitauction. br> sbr> D8217;Éioùéviede i/nc ttc=pempu/deodJàee cftache dcfdaluénneà qea énatarongphledu142djanvrerado tal8217;iaumal, rJdérssnppe8217;ioimaginaonnerntm sénle ,esaaé,cau sq 8217;estll t pa.neitdéré,mmnpmlpe8217;iou(&dqsnulusngai esédésareassessbisJrsue cds ys&dqau s cinqece tse sao(0bn csstetdeu,snmpeartlmsvauceésareasd àliioccid siedrn vetruqea8217;iansassvaglpdes Noi1s napousépa o&Afrii e).LTt sd8217;anxbord,e SsnnatarongphlCéfrtppnet àee rythmepoele nt., vccéléttsetslqds ys&tsppotle nt., baeeoté d8217;ianeéeésareasdàsl8217;antruaqbsp;;:C&esa#8217;ioie uaénneà qea évaies ess Gonaïvssdnn01504a&#i&apfaaélnéolront4000emontsoauc éismledu142djanvrera300000emontsonéolron,Mau s aucnholéta (7400emonts),&aux cyclonrsRSi eyeeséIsaac 821730; q a# épopulsonne risqiec#quttirc&rwuranaousellqcchai eeealamaéd. Ajoute1nàdc l éllstntrrtonnesc#8217;ane cfinlurssaédd(viols,rvols,rbiae age ejr rnalte,gl kidntreingdoeegulte,g)vqial#lusesieéajamai dvnébernl IL éscciéédd#uerisqiec#o nruat t#dCscciologuerbrong class="spip">JIUlrich Beckstrong>&/J(rwuradécrr ddnoe lémteulnrté)enrreeqalivevul&eopHaïtrCsneetdéaltype. br> sbr> O(utsppeontreulo dpduscmpptgvsrea8217;iaocsnrsvo pailptrt-au-Prince, ntm séunénanrpr#ladésoltonnetxc llllstntrrtonnescinhuanindsanrdinir dsàdeaa évie"idrn ncbsp;;:C&vs leur eezdrssnp1nquae léhee (,eenevoiouse lou liarcturil 4 kilomèeasseàa#8217;ioietéi r rudraa énapéblse,ona lleenrvic tcdpcnircultonnetspreéuirpte ntre ôleàdes rseiqsr#ranteuirreledoessdpapéelse#raprmpriééddetad8217;antssust ctbsp;: ;m psebidmdvia sasacsdeau, ni éltesricité,ani sndiéir dsàso ms csdlir xenrdinir dsàd8217;iohrlnttonnetewura angai eqcmîjortté depa ésopulsonne,ea qlla trssnppsneetemploàal é mnherche d8217;ane cfruviceepussibleReetxiet taddCueûn(,eeneueûn(,e(givepese#rapriè dptornisaténc&esué se cfjr rné,poueesué se cfnui elev#eo#8217;ÉOobttirc&unévisa,éunétrova l,poueu(&suchèstaa#8217;ioécole,eetc.) ad saolssviultipllsteeneiffénec,,s églissse#ra# énapéblse.pC8217;est pacupc82339;ur d8217;ave cftla tsiouaonne -ulusnprecssémesesd8217;ane cftla tnatarongphl-aqilsl/sJei igea tse#lal8217;ÉOÉtatsnrse8217;ÉOinqiaètentu&#es#raa émanrèrqndlénmeiirversl Jur er . br> sbr> LSsnnatarongphlCédssssrreeq doàvdesdaubnindsa q pdssr tnr taauslr er l lesourctsaurssilmsse#8217;ane cflégtonmaéddot jr rnpnéjàé éfaaiedntl.aDa luc teprrselpectnve,e SsnnatarongphlCésrreeq doêe lérealacé,sJrsue cslr er lds luneeseor,,edie#iagnelrluoùéla saso dorerçsesdnmpmlpdes siouaonnescqiiu#8217;avuffectt nria a# étotlrtté des sphè dsàdeaa évie&(éet ome&#e,rsccilse,onultusellqcetcsulctce t)detsdon rqial#luntmmn de nria aursrecré,rotueesaé mnteiolidersl Jeiuetsccils l vy turt pantm séunédési1n#ddnatarongphlémhezanoslivenrnla ts, qiallqséaidenàd e posul&r x-me l,eeneviconmesPft, àe énmmiele Meent rnaonnelrl,lelle-me lsot jr rnputêe àeoffrirason uidenqiiupsutaaeeraajtiqi8217;Éilumssedéhlrg,uleeeées lé moot blliltté dqcei igea ts. Cr q pdsslèvee#ra# énatarongphléeneas&aor,guds lea8217;iaord ddnaouselàdes nhon Doeolc8217;avtsppewurao l épa lexepal,aqilsl/aur er l#8217;avtsppot jr rnpua aobnédéarsue aéylelttasnnesd8217;ane méirrie cdum42djanvrerarivisns leaès l. Lpsenoen ( durs mnteitauctionvetruqeref uaénneàrsedt., clr,guot simseco ssdnlamcmlltesivitétds lea emesus,uoùé# énatarongphlé#8217;avtsppilpt mnvoyédnx lralsé,lc8217;avtsp-à-dr ddn8217;iaeccèdespaluàe éntrrtonneeesa#8217;iooubli detsdon r#8217;avupilpté tsa8217;iaoejetsd8217;anenétrova lé#raa éméirnre. br> sbr> sLs calududeesdauc e kidntreingederbrong class="spip">JICliffordrBai etstrong>&/t#iaoenrntsrecem sntéouv léàee cfaéi rt 8217;ioieteraogaonnescssdnlamnaouseévésaéllmsvducur er ,Mau sq eéessdprlicte,gl essdjgeds,a# ésurssaédd#ueu lai dnaonnelrl essdepaloyéseeeébanq eéedoessddéputéseso doimplce ésad saocedeesdau.LO(urouraltcacror ddft,ilent., q 8217;Éii as8217;iougitsd8217;anenéphiocmèneébanlrl circostcrrtpns luneéstes, l&deaa évie&sccilsedttées lugai eqcinflut clususd#pCnmurscdeaa évie&sulctce t, éet ome&#edttéeocilse.pCreseraées lunulé#sué s#cltenat cl q eésuivvnedolq deiffénec,,s istlnc tdN àlivenrnlent.,.IL édiaoenrnt,eesac deesdauctsppierçseantm séunddnatarongphl,lelle vit nre8217;ÉOintcrr ddds leaaes tguamlesoradesdaciuciineisl essdviolséedoessdkidntreingdoq pdft dofrémidn#es ftmia saot é le sanui luàe énapéblseantm sé csutovce, ,aaururnsteq eéessduciocilen ( dursueoi ss huaninpainformt., q 8217;Éia jr r#8217;iahui&eopHaïtrC#171;nbsp;?L# ésurssaéddhuanindé#8217;avtsppilpttssusésbsp;:»M.pC8217;est pal8217;ÉOÉtatse p-me ls&#i&tsppcsdnàenudnmpmlpdélinqia M.LTt ss trssnppinrn nt nrcom lsonviffectnvemt salqds ys&viva nrdrémanrèrqnnaousellqcd saol écatarongphlépseianesec,ra qlla trtovcenéeàe éfoiptursa8217;iaord ddrulctce tdetruqea8217;ianéolronlent.,.ILàueontrepcda&#i&apiartienéeàe 8217;ianéolronlent.,&tsppdraiartue(uiart msee éarsue 8217;iaeconnetewlctce t, au sq 8217;esi atsppavéréqa jr r#8217;iahui&q a# édégaidsonne elaa8217;ÉOnéolronlent.,&xc llllstntrséquutcesprctuirpesJrsue csdcyclonrs,d#pseru ids,a# é éforeatsonne,r sarolluénnes,eetc. t pal8217;ÉOexssscin eddo# éaeaieit usa#8217;ioÉtatshaïtrue.LO(ure scmppssder,alqédésmootiuaepauatao saa épesecndestntue séeocilsesrpauv ls,rmaileausonvdestntue sémonsenrs,dàladoptul&e c=vsan (upudiéivee#ra# énascadlpdes natarongphlCfi eeetedtrpt#eds ys&a jr r#8217;iahui LLessr veirc&e8217;anenécr rnpnormalàdeaa évie"idrn nc&tsppdrvtduàoueeartîtvsrearnstoas,pq a# ésiouaonne ectula prcmeee 8217;iaellure d8217;ane cfntrrtonneekafkaïne.aps saoissue,pouesrea8217;iaocsve ,ps saoaveirc&perctptible. br> sbr> I atsppsymptondtiq ai 8217;ane cfvaies esué sentnèrq- Jecmel-usesieéecndebo spo rJtxssimec&ssrse fusaelaa# é escesecnd saol8217;ÉOinhuaninsrselelqaae vl éscciééddsqcei igeeàmgai eséias IEe q oiol écatarongphl,&q 8217;Éila tso panaousellqcoueewlctce t, reqiaernrdrémanrèrqnipaé rifvddunearenséddrulctce tdeepee icaindeewureeoicrc&ere éntrrtonneee8217;Éiêeassessperflusn(flotttnéeere do# éicee tea emont) q eéso taaujr r#8217;iahui&sesrHaïtruesn(ot é leass="sséeocilsesrc tlteuies) livaésad saolssvru Dotuee saols rnputossscrmail ( daux huas rnpcarnasonè dsàdesdeesdaux&esa#8217;ioiesurssaéd.pC8217;est padr d qira# énatarongphlénaouselttéc, banelttéc, ieéaàacalpot spsojesédea mnteitauction.pC8217;est pa.ceesojesée p-me ls&#i&implce epeopeponpaqilsl/sJntrrtonnescinstmamsse#rasurssaéddsi t., crééesPft, àe évulnérlbiltté depa éscciééddhaïtruende(auc oublerurnste#evv#eo#léa8217;ÉOnéolronlent.,&dégaidédetruqeaaNasogsscin eddo# éviolt cluliésdàsl8217;anÉtatsdélinqia Mét, q pdtsppeo troas depdérssnpr esué smesus,). Est-.ceneécetcle vicir xe#8217;ioettendaseenntrepusa#8217;ioÉtatshaïtruedcda&#i&tsppàe 8217;iaopposé dqcsesaviséesPvésaéllmsslaa8217;Éillpcae esoulee c=phrlséologisscanitrifvdbsp;: ?LJticint n, cror dduedcdacetcle vicir x,lc8217;avtsppr ntentîtreai 8217;Éii a#8217;avyaaurt pairnste#eveoicreepussibleR qea énatarongphl IOdn#esir vent nrrsue caae vunespupulsonne riamrmlél/aeeootesRnqcsesaeoi ss f uamlnta xeepatxssimen énmdsciencusdddeaodigdiédd t pa.apllmsv#rarecré,rore eàmrsusl Jeiuetsccilso#8217;ÉOoùvseprctuirrt pae rmnforcent., dpcl é#171;nbsp;?L dptpee icabsp;:»Mpetsdon re8217;anené#v,veau typere8217;anÉtatssoucir xe#u0bn c-êe lécmlltesif. br> sbr> p>

L />p class="spip">LLrt-au-Prince, ,anovbre ,01512 br> sbr> brong class="spip">JILasdnuc Hurbon strong>&/p>

JIDqeaaNasivatatsonne elaa8217;anEtttRtueassdepbûe se#ral é mnteitauction sth3>p class="spip">LLL énoonne elaasivatatsonne elaa8217;anEtttR t paenéoxymtre, a8217;anEtttRétt tarsuedéfiettnsrscdJqiiéliansce deae rutivédetr cfntrc,und q eélqccmlltesif. Dqau s brong class="spip">JIHobbesstrong>&/,onetsa paqilsc8217;avtsppewuraecoi1nr on édaux dési1s&esa#8217;ioiedivi#u0(dési1n#ddau sst cl,vdeepussscin ,vdeedomenaonne821730;)u&#esa8217;iaEtttRémsg lJjticint nspo rJtmpte c&&#esa8217;iaiedivi#u0r tnrv ibrpCnmurscàcsesaeési1s.LO(uneareut&don rr esr1n#dda8217;iaEtttRcom lsc#8217;ane cfinltt cl q iurouraltcaêe lésujeéecnàaasivatatsonne.pC8217;est paneescndtrodiconneJIfinaterinstrsti>,letsmêmueneéscndetletewura anuaisne.pC8217;est p,ésrreeq-p-lll cr scndetletq pdc tnrvàépsnserdLJ8217;iauimert seicidàsl8217;antvae, siulngn eàqilsl/auttblèm(tq pdsiulèveemodJirq pétude, t pan#esirdec#qutaltcent., q ep qmcei igea tsepsuve msair dd#ra#8217;ÉOEttt, qiallq&vs àe éulusngai ecfinligdifiae, cu1nont., mêmueoù i msprétendsnté eaeévs rnewura dCccmlltesif,pouesrea8217;iaocsve ,pewurao &&#esa8217;iao ureesldL#171;nbsp;?Lleareuplsbsp;:»M. br> sbr> Ceu&#eojdJsuggèrqncaséiun8217;est pacvantéot se8217;ioimsussibiltté dqcasivatatdua#8217;ioEtttRs saoqilsc l énranteuir"s àedesdrcdtiq durs éssscin ,rmaileausonvàvdestntrséquutcespfâe u dp,dce,alcultbleseursdn#es ei igea tser x-me l,eq pdsucntmbqnMeàdc teprtu/trifne.p Ns leneconsépa lexepal,aqilsl8217;ioEtttRava nrnibiCe c=psivatatsonne o&tèglearsue aépsel tnrvnerbrong class="spip">JIDuvalip1strong>&/Jttéeséaelaies lsdet /nl ursctnec,,ea( durs ègnl,àgrâ, àe énréasnnesd8217;ane cfmae inrs éssscinrs.pTt é le saieitituénned, yscmppsilueluliéeoitpee ic, cva sntéééddorn ctésseàa#qurairvic tcexcluinf Vcs qca jr r#8217;iahui&q i eens leu es ( dursasivatatsonne elaa8217;anEttt,cil s8217;avugitsd8217;anenéEtttRq iàfonconneneantm séunddieitituénneàeetscicetcsuureeoi,antm séunélir c#8217;ÉOenrichisstme teewuree lsei igea tsertvqial#lus8217;ioouv dtauc0bn c-êe lécmlltesif q eésouseaaNasscin eddserevtddic on (svdestntue sémonsenrscetcsupulsi (,eenegénérls. Crtars,d#psedascn rnpeltauesorseae xeacce tsescanitriffsp qmcei igea tse cfmanq e nria ,rmaileft, àe 8217;ÉOenjeue#ral é mnteitauction, l8217;ioEtttRnrvnevra-p-lleilptuasnpr rsueneameéorn ctsonne rtdicale nqcsesarbjeesnfséliauisnsrnelsbsp;: ? br> sbr> Queépa lexepal,alelivenrnlent.,aelaabrong class="spip">JIPrévalstrong>&/Jprctuirsséunéarrêtéuq pdciamrael#8217;anulit=téupee ii eeot seeaneneae-vaies esa énapéblseahorpturstsué sctrc,utsonne tueesadilsoguerac ld#pserrmpriééir dsàdeamail ( dnff uaé Dotuexc llllstntm srça tse#lal ézont, au spns luneémêmueir vent nrnqi8217;Éii vr vnne.apssdn#8217;ÉOurrêtéus saoarcunesexp icaonne eueu ys,sc l édénrs,rno(&seulemt saa élégèrqéddetaa8217;iaiediffénec, àe éuttbléndtiq a#ral é mnteitauction ,rmaileausonv#esirdecfonconnenent., dpcl8217;iaEtttRcom lsieitituénneàir moot bllms, livaéeanelsdet /ne xealéasp qmchuas rnpedoessdietéiêtsp qmcei igea tsbsp;: ?LIleftuppeontreuspretreesdueq 8217;Éilcsuleieéeésaroi eft, àe 8217;ÉOumal, rJe#ueeésareasd àl42djanvrera1510, Préval riamrml-oeolc8217;avtsppseantmbleR qea8217;iaing>ie-d#pserueinserwuvoi1s q pdsinté po /anémesesocongytCarsuee cfmajortté depr esrmlntar dpbsp;: ?LDqeelsCcotétds lea eeoi seulignernqcsesaprédiabcieucs (Duvalip1,ebrong class="spip">JIAresoi#rstrong>&/oeolPréval), a8217;anectulalivenrnlent.,anedssssrnpaurcunesgènlnàd e hâor1n#ddprélev eàdes frailes ullqséareesséléléphg>iq durs#8217;ioéliangeràetJ#rsRtiansfestsc#8217;ÉOurgsntérselerHaïtr,ps saosdPsr ciec&eraa éloiàssdn#es taxes.LO(urouraltcaiultiplreralamscalud8217;ioiestaumlntalatsonne elaa8217;anEtttReontreuenevog#e,retsqii it doessdsymptôml desa# enaouseéelle-me lselaa8217;anEtttRreatéeaent Miq àeelle-me l,drsdet /nqilsl/auttjesédea mnteitauctionénranrcirdd8217;Éiêeas banelttéotuee8217;iaêeaseonyéésouseaqséareessélancila tsne xeinvdséncieucs éliangerDotueàe 8217;ÉOuidlpdes s ys&donate ls. br> sbr> sPr onaolsscas (exepalar d)o#ueutojesédeal é mnteitauction urs#8217;ioécoleenaonnelrloessdielirmnè dsàdetrt-au-Prince, (ENIP) LLes29c eptbre ,01542dunéarticlectsppiee idd tn Su ssemral brong class="spip">JIaunia Barreaustrong>&/,osouseaq titre&accusaoe lbsp;;:C«nbsp;?LAutopsie&d8217;ianeéutojesétorpnlléarsue 8217;iaEtatshaïtruebsp;:»M.pAc llsuureeous-titrebsp;;:C&SOStewura anumnteitauction urs#8217;ioécoleeessdielirmnè dsàdetrt-au-Prince, .LO(ure sr tivevul&susd#pCwebecrt&article,ojdJmenct é nt usaetreesdueicidaqsééléme tse#pseru C imsutao sscqiiu#s led tnr taessdiedic on (svsusdaa émarche bi seus,eesa#aa mnteitauction.pAupdérsrpaenégivepe&d8217;iaONGus is dp,dépsiludddnmpaasin eursdnHaïtrCdévastéea(L8217;ioécoleenaonnelrloessdielirmnè dsàétt tanff uaé exc llss len Dodiaore ,sdquae l-vangt-dixéélèvrscetcrivisnutolscieucs)ceecsdeo#8217;ÉOoffriraenacdddauc anumnteitauction urso teprécoleepewuraoinqece tseélèvrs,ps lir dàdes utolscieucsaroimpndohlrg,upttéeoutruedpédagogie tpewuraneémitseiee eueniveau ent rnaonnelrdrsdet /ndixé sa.IL éCIRH (Cmmiqsonsrsietéi mir ddewura anumnteitauction u8217;ÉOHaïtrCltenenéuprsue s ePtenent Mrbrong class="spip">JIClintunstrong>&/oeollqcutecrerainstreasehaïtrue)taa#/auttjeséssdnsamlesor.IL éSu ssemoboid do 8217;iaeccordrdàlivenrnlent.,éenrattendsqi8217;Éiu(&teraoas lialno paoffrtéeewuraomp snceralamstrovaux.p Pe eàmrsusl s ONGSéaressdnu., q 8217;Éii a#8217;avyaapilusnde&teraoas etsqi8217;Éiu(&tru a ilae elac titauction urs#8217;iohôpéblsaurs#8217;ioUnirseltté d8217;iaEtttResppélxboré.Ls8217;iaecoulalivenrnlent.,anerbrong class="spip">JIMsrpellystrong>&/t#iaidlpdeprcmeer,aeeémitsa#/auttjeséetcssoposuu#léa8217;ÉOnxursier-vnevinrz oùbsp;: ?-tàeCôors-vne-efrt. Ls lttjesérsed clr,gusamspecsficité,al éSu ssemr ntentinrnqi,alelivenrnlent.,ahaïtrued cftie nria aaueutojes IEefiel dCcneiilenent rnaonnelrdessdielirmnè dsàregivept /n135 s ys&é nt u8217;ioieterveirc&mailes saosuchèstaaupsèsd qsrx iiqttésahaïtruendsdepmu é led saolsssilc cl,voueelusnex coent., d saolcfmarronlaed. Pwuraecoi1nnherché v cdt.,êtemt salqsredus,scdeaa évalseéessdpriionnescelaa8217;anEtttRhaïtruel dCgivepe&d s ONGus is dpofiettarsuesecoi1nqi8217;Éioe&aqnttttrpt#edsttjesée xeaninpa#8217;ane cfinltituénneàqii i8217;avtspprévéléup#171;nbsp;?Lneescnqtleer videbsp;:»M,Jroeposélnàd e # éaea léremplcràgrâ, àe dpolruesnténée , xrac ld#pserwuvoi1s pee icsahaïtrues. br> sbr> HaïtrCetJ#rsRielirmnè dsào dorer#u0r tc unesexceul nt opior,unitétds lea eulusngai ecfindiffénec, elaa8217;anEttt. Com sntépeun-netsprdasrsnser drse8217;ÉOinteraogul&susd#pCtypere8217;anEtttRcapllmsv#ra#171;nbsp;?L ou c1bsp;:»Meàdc airnsterno(&seulemt saa8217;ioéliangeràroeoccupérdrémanrlscor1nsamsolidai tscc ld#pseviconmesPduc éisml,rmaileausonv#esreuplsahaïtruedi p-me l,àrsuosedttéetgnaouse dqmcei igea tse cfvalt /nrruebsp;:&?dCnecrècint n, tt ss trssnppcom lsonv#pserrmjesse#ral é mnteitauctionvneva sntécteitituer d8217;avubordrdelesourctsadea mc,,eavt /ndeprr er lêeaseroimpauc érir xersue csdei igea ts. br> sbr> Laeref uaénneàelaa8217;anEtttResppbn csneéuté-reqiase#ral é mnteitauctionvetéotl#luseraéeûrent nrrsse énmursddcxcfbusindss q pdsiicrcae cds ys&dqsRtâe se#8217;anergt cluetedesdrcdtiq dcanitrifvds s llirifvds.LSiupa lexepal,aneéulae iolideaàaconse&etJ#g clteriapssdn#8217;ÉOnéolronlent.,’avtxesoraias,cil #8217;avyaapurcuné#sué sqilscha&#s annterl/aur er luasnprapsneetemploàacturil deaStePreraseàaStePausJ orptursa ésaisneecyclonie tpft, cxcfsnstreaésado taleonore ,uneareut&qilscroîtread8217;anxenés elexenés. S8217;esee&aqntttasdàsl8217;anent rnaonnelrl (Minustahotuex xeqila&#esns ys&amipa otreas nt /s)cewura anumnteitauction,sc l écor moot déàee cfbanelttasnnesdudeésareasd àl42djanvrera1510, ae eressourctsanaonnelrlsàétt tanxcludsàdesdeecsan ( .p Enévésaéé,ae rur er ld tnrv 8217;ioimssscin ei 8217;Éii a#e nherche qi8217;ÉiludureràetJàcseaefrctuirreeot suedia sst sée xenaïfse énroyt cl q 8217;Éii aseraienauc rvic tcdpc#aa mnteitauction.pIlé#8217;avtsppq a#ra.neitdérersl Jbudgetaaeeoué eueu lai dnaonnelrl aux corpl essddéputéseetedesdsénate lseewuree aefde lccmpptgvqilsl8217;ioEtttRuet#épisRnqcsesamaigre eressourctsat pad8217;avubordrauc rvic tcdpce lsei igea tsertvigno dd#rassdcroîtpot spsce,ipere8217;anaticésaéd.pIléurr ecfausonvq ep qmc rvic ts pee icsasi t., nmaédDotueeoubltCarsuedes s rticulrernputoe se#uslr er loueeenusscu-dessusnls ot sasupçneàgrâ, àe pu liostonne eocilse.pExepal,bsp;;:C&jeareux,ps saoêeaseu(&tge /ndeprrlc.c,edasrsier d8217;ave cfvoiouse cc ldgyngphare,aairènl,àhaué-r esrureetedesd rmrpaàefru,retsaea léa euluiseete Sabeau templo# saolssvru Docom lskidntre, ldLJtup, xrausonvêeaseu(&tge /ndeprrlc.cretsaonconnenernewuramneearosssccmpptgvounewura dCcmpptgvd8217;anx i ama otreasissseqiiu#8217;avo /nrrueaàevr lcc ldneéstvic tcpee icpdeprcotectionvvdestnieonses. Lpseexepal,se cfmanq e nria . br> sbr> Laerenteitauctionén8217;avtsppewssibleRqi8217;Éiàea éntrrtonneeqilsl8217;ioEtttRsi sé é llmidds lusessaonconnedoeegalipenrs,depauatmiusessaonconnedol éjticc.caq pdsupposuuqilsl/sJloiptsi t., é llmirscetctrelce éeseursdnts len saoacctptine elaasel tnr,detsnéps ntedélir ,u&#eoa8217;iannnrreeqadesd cte lsed saol éscciééddc eile, yscmppsiluels s rtisdrulctce ts,asi t., mobiltstCassdn#es rctblèm(,esssrnpiessé#ueu ys. Com snté#es ei igea tserouraltsnt-ils,reope8217;esenfseianséssdnr x-me l,,éareséhendsr ces rctblèm(,edrémanrèrqn igtureus ecaac llsuchèsbsp;:&?d Pwurameée dtse&avo saa éniabciité d8217;ianeeeref uaénneàelaa8217;anEtttdsllefaudra q lae rur er leccordeépa lexepal,ae xeaunicipalaédDobsaurrup ilusnde&sussibiltté dqcaarticipaénne e xerrmjesse#ral é mnteitauctionvetsdon r q 8217;Éii asi sémuissahantéarsue cslemf onewura p-me l,àeséaelaies,csesaproe settéels s rtis sa.IEnedéfiettnve,eiecons-#s leasnpz q laalqédévelopient.,anesns ys&occent Ma xeepanesns ys&émsg l tsers spartio#ueutce,iperqilsl8217;ioEtttRaadûdcré,rod8217;avubordrdessdielrareauctuseDocom lsrt é l, énergie, jticc.c, néolronlent.,,adiabdtrolttasnnesepauat-dessusnot séducaonne élevéddrute Miie cme teewurets le csdcieonses,ae ,faot é lenhon Doq pd-d saolsscas u8217;ÉOHaïtr-dsupposunpaqi8217;Éioe&nrcirddcfbaneltteue cé ésareasd àl éismleet q a# épolctce tds rtis se tueesabusindss cc ld#8217;ioEtttRnrvassdnuiilptedPilptsura anumnteitauction etsdon rsura anrctuiction u8217;ÉOe cfnvenrl#dCscciééddhaïtruendbsp;:&?d br> sbr> p>

L />p class="spip">LLranis,ePt-au-Prince, ,l#dC42dnovbre ,01512p>

JIFédéraoinleent rnaonnelrl ddpolrgudsàdesdDoi ss elaa8217;anHom ls(FIDH) br> sResdaucnaonnelrdrwura andéfnnnr essddoi ss huaninpa(RNDDH) br> sCere do82338;cuméniq ep qmcDoi ss Huaninpa(CEDH) br> sbr> sCmmielii é deprcmsnppconjoiet br> sbr> sHaïtrbsp;;:C&L ésurssaéddhuanindéuet#angersth3>p class="spip">LLL ébrong class="spip">JIFIDHstrong>&/Jttéeeptornisat on (svmbre ,sdeopHaïtr,l#dCbrong class="spip">JIResdaucnaonnelrdrwura andéfnnnr essddoi ss huaninpstrong>&/oeollqcbrong class="spip">JICere do82338;cuméniq ep qmcDoi ss Huaninpstrong>&/,opee ie taaujr r#8217;iahui&udJrapior, alaeianséssdn#8217;ioiesurssaéddhuanindéqiiupsrsesoraeopHaïtrCmîlgré 8217;ÉOuidlphuandiéea léexcepsnsrnellprureor,teraès luelu éismledu142dJanvrera1510 p>

LLPsèsd qerivisns leaès leerCera l,àrlusnde&80%e#ral épupulsonne vitReontreuenedsssouptuuc ru lé#rapauv léé,ads luneeseiouaonne #ddprécai tsextre ls&# s#cltempêe Si eye#8217;avupfa paqi8217;avuggrcc r. Pwuramsslaala&#el370.000eviconmesPduc éismléqiiuvive msenntrepu saolssvcamplo#lé#éplacés,a# ésiouaonne empr dd#raursdneneuo lbsp;;:C&llstntrrtonnesc#e vit ysso doindigd settéel&dégaidt.,,aassdexpulan ( forcéqmc raiultiplre., d saolcsvcamploimplantéptsuradqsRteraoassrutivés,d#pserupulsonneseso doabandlsnénc&rsue csdONGuttéel&liveve msds luneeseiouaonne #ddvulnérlbiltté extre l.aDa lua8217;ÉOnéolronlent.,&dégaidédetruégaids /ndepccsvcamplo#pseviolt clse cffonpaqilscroîtreaetJ#rsRfemmrpart&#rsRfia sacndtinuqnMeàdêeaserarticulrèrqmsntéexposéesPa xeviolt clsesexula s. br> sbr> sLs rapior, #éploruuqilsl/sJsoluénnesrureor,tesajtiqi8217;ÉiluutenenéPa xeviconmesPduc éismlési t., nnsuffrst trpl irécai (,eepacat., eps eséa#ps rctblèm(,,sd saolsstemploetnd saol8217;ÉOespacl,àrlutôttq a#ralesdeesoudre.pCrenteitttResppd8217;anx it tarlusnnhoqia Méqira# énmmiele Meent rnaonnelrlse8217;ÉOéts msengagélnàdapior,,raneéeoutruedmasinfoàal é mnteitauctionvnuds ys&a alend rainvnudli reeqnt nr#laterasentu trrdueq i&apébranléa# enaoionvesué sentnèrq (psèsd qe300.000emontsontarlusnd8217;ane maieionvetruqmi elaasel tnrsé#éplacées) p>

LLCrenrin#8217;iou ariapssdn#eveoicéessdprpulsonnese#pseru C vulnérlbldsàdesdcamplontrc,und ausonv#8217;avtxtu/deodJ#ral épauv léédetruqea8217;ianxcluinne eocilsend saol8217;ÉOennrreeqadueu ys. Làueontre, forcc&tsppdrenteittt c&&#esa8217;iaiesurssaéddhuanindépsrsesoraet s8217;avuggrcc ,ue(uiarticulrersa8217;iaiesurssaéddeltmlntar d.IE/nc ttc=eiouaonne nernoi/nrrueaàe# éaetlrtté maileauxnnhoixndeprrlctiq déet ome&#esanaonnelrlsàlrg,unt nr#omenénc&rsuedesdeecsde lseent rnaonnelux. br> sbr> s#171;nbsp;?LL sdrulctce tsupee ii eloàacturtlteriapneareuve mseerdiseiue 8217;iaeccèsd qea épupulsonne aux doi ss f uamlnta x,ue(uiarticulrersae doi s&a alogent.,,aàe 8217;ÉOultmlntation,sàea énanéddeta1a#8217;ioéducaonnebsp;:»Meardiamraéébrong class="spip">JISouhayr Belhs="snstrong>&/,optenent Mtcdpc#aaFIDH p>

WSAeerteprubsencusdddeurssaéddsuue 8217;iaeccèsdaux doi ss f uamlnta x s8217;avujsué se cffinlurssaéddjssaeiq apsrsesoasec,rrarticulrèrqmsntéflagai tepu saolssvutisneloetnd saolesngaivds dysfonconnenent.,sd qea épulc.cretsduc ystèm(tjudiciar d.IC8217;est pane&tru a nteitttRq 8217;Éii luitr,alqérapior, p>

LLPsèsd qe70%e#ral épupulsonne caicérlseéel&liveveaaujr r#8217;iahui&uet#éte Mineearive m ecfrct#g céc,rrarfoipturau spru CiursdNxenéss,ps saoavr leccèséàee cfasinltt cl jssaeiq . Lpsentrrtonnesc#e vit u saolssvutisneloso doinhuanindsaetruégaids /ds.LDurfa padesa8217;iaiesalubi tsetruqeaaNasomiscui tsq pdsègnl., d saolcsvé llmisstme tsvuénite Mitr dp,d275t#éte uloso domontsoducnholéta urau spso ureartonne uetoctoe ,01510 p>

LLDqau s cé ébupadesa8217;iaxenés 1512,onetnteittt uneeseiouaonne #8217;iaiesurssaéddcrorsst se,ona accésaséuprsuee cfmultiplrcaonne #dsdeolèvrme tsvepaneesaugmlntation essnm(u treCarsuebaeers,re(uiarticulrersd saol ézont métoirulctnind Vcslgré cé ébupad8217;ianeéutocessusnl8217;ioépuration essnagt.,sd qea ébrong class="spip">JIPulc.crnaonnelrlshaïtruendstrong>&/J(PNH), a8217;animplccaonne #déottaoasél#8217;ÉOentreaeux da(svdestaesivitéssdélicoulun Dotueesseviol on (svdestdoi ss elaa8217;anHom lspsrsesor.p>

WSLSsngaivds éfaaiedn tdN àl ystèm(tjudiciar doso doàe 8217;iaorigind deC aépsepéouaonne #dda8217;animpunité,adesa8217;iaxbsencusd8217;iaeccessibiltté dqcl éjticc.caetruqeaaNasrsesoas tcdpc#aacor uption.pEe tutre, bn csq lae rbrong class="spip">JICneiilenSupéi r rudu Pwuvr lJudiciar dstrong>&/J(CSPJ) a paééddmipa o&place se&jtleer201512,o#aaFIDH,l#dCRNDDHoeollqcCEDHào dotxssiméa#pu lirq pétudeéssdnsnleemiartilrtté ttéeoneiedépenat cl,udu fa padesaaNasrsesoas tcdpsevla éitéssd8217;anentsomissnne #dda8217;anExursiffsd saolssur er ljudiciar d.IDrassdcroît,e 8217;iaordlsnancusdueuuglpdiamrat tarreCcrrteaolcsvclrg,useursdniioccid setéosimencofeasea8217;anHuandiéé àe 8217;ÉOencofeaseuesa8217;iaxeen cseicoao, l brong class="spip">JIan SClau#r Duvalip1strong>&/Jsiulèveedec érir xedt é leqia Méàe évt#g té dqcl éjticc.cahaïtruendedrenteuamneralamsex con (svcmmiqs/sJsoulea eeicoaouse p>

LLD saocedct é x,,,eleérapior, a egalqmsntésiulngnéJ#rsRieteraogaonnescq pdse posunséssdn#eérôes esa éMicin eddseNaonnescUetesavclrg,éusduemitseiee #ral épaixaetruqeaaNsurssaéddeopHaïtrC,ea ébrong class="spip">JIMINUSTAHstrong>&/ p>

LLLesdeesultass elan Dotpéraoinlloso dotsèsdmtongéseetesiulève nr#lanore ,un Docrrtii eloàa#8217;ioietéi r rudueu ys. Sirpe&a ar oenrl#dnt nr#laeoneandett,l#dC42dOctoe ,01512,pewuraneéanarsue csCneiilendddeurssaéddddseNaonnescUetes,o#aaFIDH,l#dCRNDDHoeollqcCEDHàaccuilele msaivorlbldmt saa éeéuiconne #dsdeffectnfseiniitir dc caséiu&#esaa urmn de ad dssé,ae xes ys&q iàfournissrnpad sacndtingt.,sd qeaea léeopeor,,eqiralesd ctesameéetnéeerredus,nl urscressortissa tsefassrnpaa8217;iaoejetsd8217;anerq êé lettdsi t., st connené p>

WSAès leerCnteitttRessnm(nacese#pseru C gaivds qiiupèsunséssdn# ésurssaéddhuanindéd saoce deiffénec,sadoaninds,o#aaFIDH,l#dCRNDDHoeollqcCEDHàsouha ot., ietereeslddn#es rcce,ipe xeacte lsedecsan (nels naonneluxertvint rnaonnelux qiiuo.,,aàeeiffénec,sadegrés,ae rur er ldameéformtr,d qeriansformtrdetad8217;animpuls eàdes rulctce tsucapllms durs ésodereeeux défilududeelèvrme t u8217;ÉOHaïtrCetruqea8217;iaé llmisstme tad8217;ianeéÉtatsde doi s p>

WSAeerteprfiel dCrapior, formul,aneénnnrreeqadeé mntmandettn (svcmecrècipl iarmnv#psqlla sRfigure t #es rcciqttésasuiva tdpbsp;: :p>

WSbrong class="spip">JIeJIA xrauiiqttésahaïtruendssti>rbtrong>&/p>

WS821726; Grdiseiuedpsentrrtonnesc#igd sedeé mlogent.,éenrudJacnmpaagnent.,anesn#éplacéséqiiuvive msenntrepu saolssvcamploetéotlssdn# édusésbsp;:&;sbr> s#11726; Meée dtse&82339;uvr,alq dmesus,sénmeiirvator dsàdeandeénc&rsue a Cmmiqsonsrsieteraméi caindedestdoi ss elaa8217;anHom ls#dC46dnovbre ,01510ncofeaseassdexpulan ( forcéqmbsp;:&;sbr> s#11726; Meée dtse&82339;uvr,alq dmesus,sénmeiirvator dsàdeandeénc&rsue a Cmmiqsonsrsieteraméi caindedestdoi ss elaa8217;anHom ls#dC22dnovbre ,01510nse&aiveuradqsRfemmrpart&drsRfia sa#éplacéesbsp;:&;sbr> s#11726; Pssder,alq dmesus,séniabciir dc ewura té uecofease# ésurpupulsonne caicérlseéepacssuseuedpsentrrtonnesc#et#éte Minee#igd sbsp;:&;sbr> s#11726; Jugddn#es rsel tnrséuet#éte Mineearive m ecfrct#g cécéepacssuseuee cfasinltt cl jssaeiq oàacha&#s psel tnrvarive usbsp;:&;sbr> s#11726; Meneraà bn cs cslemcessusnls formaénneà qea éPulc.crNaonnelrlscaséiu&#esaeéutocessusnl8217;ioépuration esea éPNHbsp;:&;sbr> s#11726; R fusersa8217;iaimpunité ewuraan SClau#r Duvalip1bsp;;:C&q 8217;Éii aau ssemêeaseuugé tténteuamnddeopureescursdn#es osimesncofeasea8217;anHuandiéé psepéorésJsoulessrseegnmebsp;:&;sbr> s#11726; Meée dtse&82339;uvr,aenétrova lé#raméirnresuedi8217;iahonn, leesseviconmesPdeea eeicoaouse p>

LLJIfbrong class="spip">JIAa# énmmiele Meent rnaonnelrlstrong>&/Jsti> br> sbr> s#11726; Appuytrdetarmnforcer saieitituénnedt#émoccdtiq duuds ys&esée té uecofease#esdrcdtiq durscor uptionbsp;:&;sbr> s#11726; Assuseuee cfulusngai ecfconrdinionne #dsdrrmjesse#ra mnteitauctionvetruqedévelopient.,acc ld#pseacte lsepee icsaetcssivésé csut eilegna t #es soluénnesrdusllmsslaaiduciocie t #es rrpulsonnesentrc,unéqmbsp;:&;sbr> s#11726; Mensr ces rctjesseensctrc,utsonne epauata(naria,acc ld# éscciééddc eiledhaïtruendbsp;:&;p>

LLJIfbrong class="spip">JIAusCneiilendddSurssaéddddseNaonnescUetesstrong>&/Jsti>p>

WS821726; Areesdue éMINUSTAHaà r ntentîtreasaé moot blliltté d saolssdiamenchcnt., dpcl8217;iaépi#émidedrenholéta eta1aé llmiraneescnmiqsonsrspseianesecnde riamrmaonnesbsp;:&;sbr> s#11726; Exi,uleeeée éMINUSTAHaq 8217;Éila tcmmielii eupee ii emunséssdn#eésrivi #dsdrrmcédus,séimplce a t #es soldass rapatriésàetJ#rsRrrmcèsaietonéseàa#quraencofeas,a o&rsetue#ral épolctce tdls otlétarc,-zérobsp;:&;sbr> s#11726; R ntmmn deue 8217;iaemend rt., du Soaou eofaFonces Agreent.,éefease#esdNaonnescunirscetclelivenrnlent.,ahaïtrue,d qemanrèrqnàscndtroider,alq dsoldass eeée éMINUSTAHa moot bllmssc#e viol on (svdestdoi ss elaa8217;anHom lsàdêeasesoucsdnàeddc ewursirpesJnevantaenétribuelrdes doi s&cmmielee saols rds ys&d8217;iaorigind p>

LLJICnetactsprcmsnpstrong>&/bsp;;:Csbr> sAudreysCnuut ,bsp;;:C&+33 1 43 55 14C42/&+33 6 48 05 91 57 (à ranis) br> sArth rdManetbsp;;:C&+33/1 43 55 90 19 /&+33 6 72 28 42 94 (à ranis) br> sPreraseEspsee ctbsp;: C&+509 37762101 (à rt-au-Prince, )p>

L />p class="spip">LLranis,eoctoe ,01512 br> sbr> p>

JI LES POSSÉDÉS DE LA PLEINE LUNE p>h3>p h3lass="spip">JIan -Clau#r Fignolé p>h3>p h3lass="spip">JIarift, #r Yvds Chcnlasth3>p class="spip">LLbrp Sass="s'ip">_documlnt_1536 ip">_documlnts ip">_documlnts_cesecr' >p img src='local/cae -vigd té s/L220xH336/aoenpusssddc_web_eec1bad00de7fd1a48dfb38e86d06a28-2e301.jpg' width='220' height='336' pelt="" style='height:336px;width:220px;'Sass="s'' />strp sbr> sLs utecreratitre&eeée égai ecftrilogissecfan -Clau#r Fignolé LSsnnui ludeprueineéeunc,ra spstrpe&vaies ess Abi cots,re(uHaïtr,lmèneée cfvaeeent eii.IL écsdèrl,rmauvaisdCcneiilelèrl,rrivèl,alq dhuaninpaenépsepéouelantmba,acc ld#pseéléme ts.IL éteraseetJ#rsRhrlntt tsvulre., soulea esénhermsnppetJ#rsRcyclonrs.fbrong class="spip">JIAiioc1strong>&/Jewursirpaneéuorsssrsborgd 82170;nbsp;?L;fbrong class="spip">JIVioltttastrong>&/oes, antureusuu#léa8217;ÉOnaucttruqeaaNnui 82170;nbsp;?L;fbrong class="spip">JILouior,,snpstrong>&/,cressssnppsaRhrindéutéeséve gea ce... Lp lsesontso raiêlenéPa xehnltor dsàracndténc&rsue csdgai es-mè dp,duqegénérlonne uetgénérlonne. br> sbr> sÀuiartir d8217;ave cfaipal,enhronie tpvaieageorsl,ran -Clau#r Fignolé brusss,neneuo a.,acc ld#8217;iahumwuradlats le csdregtreass,aneescnsmogg>ie imaginais,uoùée aefliveve msl é mligine vodou,d#pseru dNxecruesnmyt se#ra¬a8217;anEuempuCetruqea8217;iaOrn ct,a# éslonseéve gerrcirdd8217;Éineeseociééddoùésègnl., #8217;ÉOurlntrarreledo#aacor uption.pUnlmtrddJréinvdntétds lea elu, l&deaa élunppetJ#rsRvapeu1s&esa#8217;ioalconl. br> sbr> p>

L />p class="spip">LLranis,ePt-au-Prince, ,l8eoctoe ,01512 br> sbr> p>

JIFédéraoinleent rnaonnelrl ddpolrgudsàdesddoi ss elaa8217;anHom ls(FIDH) br> sResdaucnaonnelrduqedéfnnnr essddoi ss huaninpa(RNDDH) br> sCere do82338;cuméniq ep qmcDoi ss Huaninpa(CEDH)sth3>p class="spip">LLCmmielii é deprcmsnp br> sbr> p>

JINoptornisat on (svurmn de msl éfie #dda8217;animpunitéeesseviol on (svdestdoi ss elaa8217;anHom lscmmiqs/sJrsuedesdagt.,sd qea éMINUSTAHsth3>p class="spip">LLbaRhref="http://www.fidh.orn/Nop-ornisat on (s-urmn de m-la-fie-17262"lass="spip">_out">http://www.fidh.orn/Nop-ornisat on (s-urmn de m-la-fie-17262 br> sbr> s Aaa8217;iaoccasionvnudr oenrl#dnt nr#ueandett esa éMicin eddseNaonnescrwura anSoabiltslonne uetHaïtrC(brong class="spip">JIMINUSTAHstrong>&/)àqii i8217;avae èvee#dC45eoctoe ,,o#aaFédéraoinleent rnaonnelrl ddpolrgudsàdesddoi ss elaa8217;anHom ls(brong class="spip">JIFIDHstrong>&/),l#dCResdaucnaonnelrduqedéfnnnr essddoi ss huaninpa(brong class="spip">JIRNDDHstrong>&/)àeollqcCere do82338;cuméniq ep qmcDoi ss Huaninpa(JICEDHstrong>&/)àureesld taleoCneiilendddeurssaéddàdce,luse dqmceispriionnescrt&drsRmécisatmdc ewura té uecofease#8217;animpunitéeesseviol on (svdestdoi ss elaa8217;anHom lscmmiqs/sJrsuedesdmbre ,sdduacndtingt.,einiitir dd qea éMINUSTAH. br> sbr> Ces elrnrèrqnxenéss,pe éMINUSTAHaaadûdaea léft, àeru CiursdNxllég on (svde gaivds viol on (svdestdoi ss elaa8217;anHom lsvrst tedesdmbre ,sddlaeonepsel tnrl, yscmppsilu#e violt clsesexula s.LSiu o&rsetue#ral épolctce tdls otlétarc,-zéroprcônéuprsue 8217;anJIONUstrong>&/,clq dmniitir dc mipa o&edus,nontééédd mnvoyésee saols rnpu ys&d8217;iaorigind,&seulemt sarivisncas fonpaa8217;iaoejetsd8217;anu(&suivi judiciar d.ILSsnx i amacas sinté o padem(u éséimpunis,asi t i mst doftrpt#8217;iaoejetsde ewursirpesJnevantadesdjssaeicon (svmniitir dc, abo sst séot saueelusnàeddc st connemceisciplrnir ds. br> sbr> sPsueaaies rn,se8217;ÉOi atsppmitse nt /lassirent.,&déponpré&&#esa8217;iaépi#émidedreJInholétastrong>&/,cq i&apbdtroînéa# emoicéesàrlusnde&7000ersel tnrs,pasé tseduséuprsue 8217;anxbsencusd8217;iaielrareauctuseDosndiéir dsàsura anbasdd qea éMINUSTAHnàeMr dbelai ,sc lle-ciacndtinuqnàenir1nsam moot blliltté d saoso ureartonne,petJ#rsRviconmesP#8217;avo /nreçuaurcunesrérsrlonne. br> sbr> sFt, àecedct é x,,ad8217;animpunité,al éFIDH,l#dCRNDDHoeollqcCEDHàareesld taleoCneiilendddeurssaéddàdexi,uleeeée éMINUSTAHaq 8217;Éila tcmmielii eupee ii emunséssdn#eésrivi #dsdrrmcédus,séimplce a t #es soldass rapatriés,a o&rsetue#ral épolctce tdls otlétarc,-zéro, eta1ar ntmmn deue 8217;iaemend rt., du Soaou eofaFonces Agreent.,éefease#esdNaonnescUnirscetclelivenrnlent.,ahaïtrue,d qemanrèrqnàscndtroider,alq dsoldass eeée éMINUSTAHa moot bllmssc#e viol on (svdetdoi ss elaa8217;anHom lsàdêeasesoucsdnàeddc ewursirpesJnevantaenétribuelrdes doi s&cmmielee saols rds ys&d8217;iaorigind br> sbr> sL éFIDH,l#dCRNDDHoeollqcCEDHàareesld tal éMINUSTAHaà r ntentîtreasaé moot blliltté rsuenégligt clud saolssdiamenchcnt., dpcl8217;iaépi#émidedrenholéta eta1aé llmiraneescnmiqsonsrspseianesecnde riamrmaonnes.IDr dmesus,sése&aiveuradqsrérsrlonnesmcmlltesivrscetciedivi#ueeers,rcaséiu’aner&aiveurad8217;iaievdséncieme tsvendielrareauctuseDodqutaltcent., #dsdeluxeretHaïtrCnevra sntéégalqmsntéêeaseroimds. br> sbr> sAaa8217;iaoccasionvn8217;ÉOentretruesncc lddesdmbre ,sdduaCneiilenddsNsurssaéddesédea mutenenéa tsepseianesesaaupsèsd qsrNaonnescUetes,o#aaFIDHoeollqcRNDDHoo dortenenéévd8217;anx i ama mntmandettn (svds lea euselpectnvevnudr oenrl#dnt nr#ueandett esa éMINUSTAH,cq i&ce,lud tal édiminution eseelsCcodtingt.,einiitir ddeollqcrmnforcent., dpcsafconrdinionne cc ld# éPulc.crNaonnelrlsHaïtruend,cq i&nevra téêeaseuedmesus,uesa té ueefficac nt nrcofease#8217;aniesurssaéd. br> sbr> sCmetactprcmsnpbsp;: C&brong class="spip">JIArth rdManetstrong>&/o- Telbsp;;:C&+33 6 72 28 42 94 (à ranis) br> sbr> p>

L />p class="spip">LLrt-au-Prince, ,a-eoctoe ,01512 br> sbr> p>

JI Espaclcpee icpetnumnteitauction u8217;ÉOHaïtrsth3>p class="spip">LLral brong class="spip">JIeJILaëdnuc Hurbonsti>rbtrong>&/ br> sbr> p>

LLL8217;ÉOespaclcpee icpntenrs,rewura dCse(svcmmiue uetHaïtrClssvru Doencore é led8217;iaé leagep,duqegsrlg,séimptovcsésl essdplacesupee ii eloriansforménc&rsuMiie cme teoueestalqmsntéuedmarchés,d qeriottoi1s q adrnllésvendbo e ts,areatsust tsvepa otreasisssedirseles,ae ,fa#dsdespacls&occupédNxearchii emunsérsuedesdflotludepr yss lerejetés&esa#8217;ioagrinultuse,retsqii crore Méqira# évie&seut&fls r luarot saaies rnsqilschezaeux. Bn csesecndu,sc xeqilu#s lenmmi ( daujr r#8217;iahui&r yss leit doesau s g>&templo#ér yss é ,sc rsdet /nqi8217;ÉOi snumnteitauise t #es campagd seruselepa o&pleieéc82339;ur dea énapéblse.IDéeoimai ,so(ure sdr d qirart-au-Prince, tsppeo umnteitauction pseianesec,rmaileeo ta Méqiravaies rusele,vds lea emesus,uoùé#8217;ianxrdec#qs campagd se#8217;avupjamailecesséoesau s éfie #u XIXcfaiècle,eet i8217;avaecélè dtaucfuràetJàcmesus,u&#esaeéu ys&e8217;ÉOinttallqcd sao#qs csissserulctce tsuetJéet ome&#es. Queés trssnp-p-lleq i eedrassdcroîtp#qs catarongphlCfnaousellqs ( éisml,rin uaénne ,scyclonrs) vnne.antéel&mélangerààpccsvcsisssbsp;:&?d br> sbr> Ns leeconsévuJjticint nsomp snt,aàe# éaevr rudue ésareasdmajr rue tdemutenenéeuelu éismledu142djanvrera1510, éot scr q pdsssts msoueéts msierçsocom lspee icpasé tsrapident.,éenr ysténdtiq mesesoccupé,aaururnsteq eé# éviies esart-au-Prince, nrrees msumneer ll8217;ÉOestocadlpinrn eseelsCurbndiéé. Com sntédon r rsnser souerersnser l8217;ÉOespaclcpee icpd saolssct é x,,adral é mnteitauctionvpost- éisml,roueelutôttd saolssuttjesé(enntreputopiq )adral é mnteitauctionbsp;:&?dEséot sd8217;avubord,anedsslèvr-n-netPilptqila&#esnmamssecndus qiiuplanunséssdn#eéctrc,ptsd8217;anespaclcpee icpJ orpqi8217;Éioe&tsppewréddàd#8217;avyacoi1nriee #8217;anx i au&#eoa8217;ianspaclcphysiq bsp;: ? br> sbr> Il yaapneeshnltor d adral édégaidsonne elaa8217;ÉOnspaclcpee icpan on éuprsue s regietédderchitectreJIAlbrtéeMangonesstrong>&/Jdèsd1955 (er llra mnuilend8217;ÉOurticlespiee iddee 2000eral brong class="spip">JIFOKALstrong>&/)ààcssoposedrenrteprrt-au-Prince, q pdse priaiprpe&ve,gusamdiahét cl com lsvrleqaduefa padeseoneiecaplcaéddàdgérersl8217;ÉOnspaclcer&aonconneadral édémogaiphid. Pwurta M,éefease1946éenr1956,a énapéblseaoffraitReontreue cfimagec#e villprutriayt se,oepa l dCcmpptltcaie lsiarmnv#pscmeaies rdsàdestinionnesnot resoiq durs#a Csrlïbd.ILS frt does mtrddippbncesecnea léreutenenéarpaneélir c#ssuttm(na#ssuoùé essdpsel tnrsé#eaot é le santue séeocilsesrpouva sntée aefdcofeasdn#eveoiràetJ#rédimanchc Vcs qccl q 8217;Éii acofv t., nmmédiacent., #d&aqnsee tr,dc8217;avtspps ésurssaédd#uelir cauc oublerniveau néolronlent.,lrd(ubsencusdddrolluénne)àeolvéblsa(pasp qdkidntreing,d qebraq igernioes mtu treaà répéttonne). br> sbr> C8217;est paàuiartir d s#clterrr ruduvaliésast &&#esa8217;iao omp snceaàefuidn#es espacls&pee ics,dc8217;avtsp-à-dr d qira#es espacls&pee ics omp sncentJàcseaearéfi r. Eo umvanchc,osouseaq eegnmeedreJIan -Clau#r Duvalip1strong>&/,so(u euuoavr lrsdet /nqila&#esnnxenéss e#8217;animpsscin ed8217;Éineeslibérolttasnne,rmailec lle-ciasssts msorn ctésrewura dCbn c-êe léd8217;ane cfmin saéé,aetolssct érareeeéts mssais sst séec ld#pseJIboamsieoprlsti>rq iàfuya sntérselelaaF orid stueassdîassdBahamas.aDa luaeaie lstempl,clq dbidofv ll,se cfcessrnpad Cgivssireetedec raiultiplrer ta dis qirart-au-Prince, dev t., re eàmrsuso &&#es#s lententiss ( daujr r#8217;iahuibsp;;:C&l8217;ÉOengorgent.,,alls&occupionnesnxearchii el,cae ,fao &&#essero t #es camp durs éfugnéseduc éisml,rje&ve xersululeeeée émultiplrcaonne #dsdespacls&d,rno(-doi s, q 8217;Éii as8217;avugicirddon rees q auMiirs rrpulsis,sénmeitituésvendzontsNsursuéss (é#eaoyperJIaiartheidsti>)eoù i &tsppdangereux&esael&livever (#rsRhrlntt tsvr x-me l,edepccsvespacls&so t #es utecrersaà r ssrnpirsae danger).LO(urouraltcarsnser qira#es espacls&pee ics so taaujr r#8217;iahui&occupédNral #171;nbsp;?Lleareuplsbsp;:»M,dc8217;avtsp-à-dr d santue sérrpulsis,sépauv lsrees bidofv ll,s,eet q aceaseraienaaséiuunJjticiaeflwuradlajticc.c, l,sépauv lsrreas nt /d#pseruacls&d8217;iaoù i mséts t.,éenr o dotxclui. Aa# évésaéé,ac ttc=eoi-drst séjticc.cae pane&pura durae,ona aneénspaclcpee icpJnoi/nêe lédgéré,dc8217;avtsp-à-dr d élégiféréprsue 8217;anÉtttdssousepeind deCsore ,rnd saol8217;ÉOxearchiuCetruqednenern ibrpCnmursce xeswuvoi1s ees gangs qii,a o&fie #ddcmpptg,casivatatd Méàe s rdsemf on, q pdnevra tédem(u e aneénspaclcpee ic. Revtdnesnàe 8217;ÉOucctptine vésaéllms elaa8217;ÉOnspaclcpee ic.IL éi elonneadral ésurssaédd&&#es#s leeconséeioué,ae utecreraulae rcmeeseonese(svetrméi ,,ad8217;anêe léte usrewura 8217;anu(&#dsdrrésupposés&esabasdd àe 8217;ÉOexesore, sd8217;anu(&nspaclcpee ic.IPwurquoibsp;:&?d Paro &&#es, q pdna accésaslaa8217;ÉOnspaclcpee ic,lc8217;avtsppsea ibrpCeccèsd qets le csdcieonseseàdc t espacl,àc8217;avtsppr tc un&nspaclcq pdmanrlscoruetJé on sssilc cieusunt., mneadoi s&d8217;iaecc lueibrpCenvesué ssurssaéddcom lscieonseeàdc t espacl.ePtecisneloc ttc=uttbléndtiq . L8217;ÉOespaclcpee icpnteititueobsaurrup muissau(&nspaclcphysiq sqi8217;Éiu(&lir coùée adévelopientedesdrcdtiq dd tcmmielicaonne àuiartir d sresdaux svrst te àudaea léuasnpr desdfl xe#8217;ioopini (svsusd#es rctblèm(,entrc,uno saa évitcdpc#aacomiele Meoue#ral énrifne.pLS célèbreseociosoguerae cma d,ebrong class="spip">JIJüg l Habseiasstrong>&/,osoutre Méqira#lcpee icpenéi elonneadral8217;ÉOespaclcpee icpn8217;avtsppriee #8217;anx i au&#eo#171;nbsp;?Llaeestalitéeessecieonsesbsp;:»M. br> sbr> Jticint n, i a#e re sexesorrsd8217;anespaclcpee icpsoulee c=eicoaouse,rno(&rlusne tdl8217;anespaclcpsivé.pTt é bocseicoao, l s8217;avugaclcrapident.,édqeaaNasolifération essnm(dialettdsurot s#uelibresdévelopient.,anueuo lnelttmee#8217;ioopini (bsp;;:C&u(&seulne otidruedi p suffrt,aneesseule rtdioéutéeséarossscchaindedeéléléviin ,ri ai p ftuppmitse nirJsoulessrsct érôes jtiqise#8217;animaginais,udestnieonses. Lpserasnpreeqnt n durs tdlsvro t êe léent rdips, àe 8217;ÉOexctptine elac xeqiioso doàesamdivosnne,r#pseaciocittn (svdoive msépivever dral édifficultddàdobe nirJae doi s&decfonconnener,r#pseécolel,clq dunirselttésàetJ#rsRneneae dd tcmnfénec, scrt&draoinénd821730;l#luso dorac ewura i #dsdlieux&esadiffusnne #ddrsnséea ibrpbsp;?L;fe ,f, a8217;aniedivi#u0nraursitàrlusnde&# emoidereeeutt ome .LO(uirddoué sqilsl8217;ÉOespaclcpee icpne re sêi au’ane cfcmnq êé aà raviveràetJàcnteiolider acndtinuqe cme t,ona ai vrisq oàaot snont., esabascul,rnd saoo &&#esHabseias ureesldLa éntrrtonneepanoptiq , ligdifiaesérsuelà i eeot ra# évie&e adé ou cosousea8217;an82339;i acxenibaeqadueuwuvoi1.aDis-moi esaqilaénspaclcpee icptue#asrsiescrt&jlétesdr aieotnrniveau d8217;anÉtttdes doi s&etruqedémoccdtid br> sbr> sEopeomml,ri a#e suffrtPilptqi8217;ane cfvillpruit #dsdespacls&pee ics psilu# saolssse( dursalacesupee ii el,d qereraoassr ibrpl,d qeru scrt&drariottoi1s denengorgés. Crtars,dccsvespacls&dem(u entciedisrsnsllmss, i msformtntJ#rsRielrareauctuseDodqul8217;ÉOespaclcpee icparosssnt., eit.pCre’ane paàuvra sdr d a8217;ÉOnspaclcpee ic,lc8217;avtsppot sàe# éaoilecesRielrareauctuseDort&#rsRfl xe#8217;ioopini (svqial#lucessrnpad8217;ioaltmlntdue évie&sulctce t,retsqii rrmcède msvirturl#dnt nr#laa8217;iannnrreeqadesdcieonses,aot é lenss="eDort&ot é lenatégorn séeocilsesrcmnfteuies. LpseielrareauctuseDoserveippr tc envesué utecreralir cà cssoposur #dsdlieux&rsueoùérssnppclcq pdtsppvursnd saol8217;ÉOespaclcpsivébsp;?L;fellqs serveippr tc àsaivoratdua#8217;iotxssscin edddpriionnesceirselesàsura anvie, #8217;iahnltor d ept#8217;iaorn ctsonne ecoulaes esa énlonne. br> sbr> Com sntédon rexp ie traqi8217;Éioe&pu ssemralluleeeée éumnteitauction ursrt-au-Prince, ,ass leqi8217;Éioe&m ttc=àe 8217;ÉOuvant-postse#esdrctjesseq pdntrc,undn sd8217;avubordLa éntlltesivaéé,ac8217;avtsp-à-dr d c xeqiioliiupsrm ttc., dpcs8217;anint Mifi rdetad8217;anavr lu(&sentime tad8217;iaureare nt , s(sàe# énlonne), #ddcmppssder,ae t,rie lse8217;ÉOi atxesoradqmceispaqttésasocio-éet ome&#es,sêi auHaïtrued 8217;avtsppia aacinmilllms àe éuostonne d8217;ane cfquasi-eth>ie (dcom lso(urouraltcaêeaseuesa8217;iaeth>ie Has esa,eoue#ral8217;iaeth>ie Baka),rmaileàe éuostonne dlscieonseeàdl8217;iaégal 8217;1;tauc0niveau des doi ss f uamlnta x-d qets le csdx i amacieonsesedueu ys. Pr onaolsscas qeMornlnàdCabrrCetruqeCxeaandLJtus isNxllénàdCaeaan (sura anut raess Arctdins) erq êé lcc ldd8217;anx i amanhercheurscvsusd#eu lirttallation e saol ézont, j8217;aner&su spsortioestalqmsntéabasr r#iupa lo &&#esj8217;ana sobservé. LesdrctjesseuqeCxeaanCetruqeMornlnàdCabrrCo séot s 8217;ÉOuirad8217;anêe lédesdrctjesseq pdntrsesorntJàcseadébarrasnpr depclcq pdtsppnteititueounesgên .LO(uyodiaouvr,ass lepeind e cfabsencusestalqsd8217;iaielrareauctuseDo(eau, électricité,art é l, r#es,sécolel,cneneae dd tnanéd,adesaoilirs,dd tcmnfénec, s,ed8217;iaécolel,cetc.LO(uomp snceapa lrctuirree#dsdlogent.,Do(c8217;avtsp-à-dr d desdalvéolel)ane&pesocom lsc xeqilusesrcmlonaooffrairntJjadileauxnesnssvds saols rd#171;nbsp;?Lbndtébsp;:»M-,&pu seqila&#esns ste lseimptovcsés mnetc., dpcot é lepiècesRcc ldauda tcdpsebaraq meses serva tad8217;iaégli"eDort&d8217;iaécoleleu ys /ds.LEopattenda M,énetPsustapa ésaueelusnssscid,adust t lsstemploqilusesrgangs fonpaa euluiseete Sabeau templo# saoccsvespacls&qiiu#8217;avsusonpabn ctôttrrueaàeenvreraàdCitéeSolei a(#ueauissau saolssvxenéss 2001-2006).pIlé#8217;avyaapiasélir c#ssusnser qirac ttc=eiouaonne tsppmirgnrn e/nqi8217;ÉOlaes neécor moot déiaséàec lle dea énapéblse.IAu f u,&&#essetrssnp-p-llecc ld# épolctce tdnaonnelrl dddlogent.,eoueeontreucc ld# éumnteitauction ursebâtime ts&pee ics do tanstam snté#eeu lai dnaonnelrbsp;:&?dPr onao tcdprnir1ncas.aIléue 8217;ÉOuvantagec#8217;anêe léflagai t. OrénetPnherche o&ritsa#séareuveu&#esaeéu lai dn8217;avtsppia alséarossiééddpsivédedreneliiuqii,a o&utce,ipe,aneda8217;iaoccuperqilsptovcsoirent.,. Ls l lai dnaonnelrdtsppnsnsévêeaseu(&nspaclcpee ic.IPwurquoips saoarcuneseiscucin eec ld#psentrc,unéDo(qial#luso dorac lssutenent Mrutéeséaelaies,cmaileleareuplsahaïtruedàétrovselelpseaciocittn (svded# éscciééddc eile),pe8217;esen&aqntt-ne àuurseONGuoueaipal,menéPa xeÉttts-Unisbsp;:&?dPsnser l8217;ÉOespaclcpee icpne re sdon rrac êeaseeéuii sàe# éseule nteitauction urslogent.,Dorsue csdaelaiessbsp;:&; i as8217;avugit&draoré,rollstntrrtonnesc#8217;anu(&nxercc.caeffectnf dea énieonsenetddàdtrovsele#dsdlieux&susctptilms durs mnforcer olrueéeocilsorsue csdcmmielicaonneleqi8217;Éii msfivoratd.,éefease#esdiedivi#usvepa otreelpseaciocittn (svded# éscciééddc eile, etsdon rrsue a focalttasnnesdeée éumnteitauction susd#es i elonnesrrelevantadeo#171;nbsp;?Llaenhon upee ii ebsp;:»Me(sécolel,cneneae dd tnanéd,aoinénd,aoirculsonne,ps lle dd tcmnfénec, s,despacls&d,rrasnpreeqnt n ,dmarchés,dmneunt n ,djardincpee ic,letc.). br> sbr> p>

L />p class="spip">LLrt-au-Prince, ,a3eoctoe ,01512 br> sbr> p>

JIHltci-Polctce tbsp;;:C&Une rérirdec#8217;iaébullioinleendiciocitblqsd8217;iaunesréfltxeneearof uesth3>p class="spip">LLPal brong class="spip">JILeslru Péanstrong>&/o* br> sbr> sSoucsdnàebrong class="spip">JIeJIAlé Pcmsnpsti>rbtrong>&/e#dC4 er octoe ,01512 br> sbr> HaïtrCesppeo rueineéébullioinleetépeun-êtasdàslséverleqad8217;iaunesrévoltc=urpulsis,.IL égai ecfmanrlscoasnnesdudNordrdàl27éseptbre ,0iaouléna i luitrée 8217;ÉOexesore, d8217;iaunesconjoncouse dqvcsiss inmillirqnàsc lle &#esaeéuhilosgphlvxeglai dbrong class="spip">JIJohn Lockestrong>&/t#ifietciirppeo 1690ocom ls#171;nbsp;?Lneesrébeieionvviinbll,roursetruetJéassoasec [1].bsp;:»MeÀa énapéblseaPt-au-Prince, ,l#dC30éseptbre ,01512,pbrand sst sélsscarotnrrt ge ligdifiaesél édisqualsficasnnesdudutenent Mrbrong class="spip">JIMsrpellystrong>&/tesaa éniabciité dea#8217;iotxsuls eàduereraoas&sulctce t,rru CiursdNmaieisele#dfmanrlscoa.,DocsiairntJJIVaeéu vll,rfòléurlsti>r(Q 8217;Éii ale&ve rleqaouen ,ri anoi/niartir) [2].IL éutenen tcdpsebrong class="spip">JIPausJDeetcstrong>&/,obrong class="spip">JITurnlbJDelpéstrong>&/tesadlanore ,uxdx i amatioc1Dodqul8217;ÉOopiostonne démoccdtiq eàdc ttcfmanrlscoasnnestspposèsdligdificrifvd.aIléftuppmitse nt séoar d sant éraeicon (svs ntedir dc cc ld#pdmnuvrme t brong class="spip">JIssvass="estrong>&/tesaut eilegndue ént éraeicon ( rcce,ipele cc ld#pdur er lebsoluénstreJItèt kaléstrong>&/.IC8217;est pao &&#esurmn de # emoidereeréfltxeneemaileausonvcl q 8217;Éiexi,ueaq eeelttmebsp;:&! br> sbr> sLssant éscoasnneserueuve mscofease#elivenrnlent.,bsp;: C&brong class="spip">JIMiragoânt, Pstrp-Goâc ,uJérémid,dCay s,dL éChaeesldstrong>&/,ottdsurot se rbrong class="spip">JICap-Hltcisnstrong>&/eoùérivisnmanrlscoasnnemst doeuélir c#sau s cé13éseptbre ,0cc lddesdfou csvscandantadesdcsilu#e colèruCetruqedeneooti1.aAaies rn,sa éeéinltt cl s8217;avornisatd.ICofease#8217;anurlntrarreledo#8217;iaiejticc.ca#8217;anu(&chef d8217;anÉtttdqial#agec# saol8217;ÉOimptovcssonne epaaccumul,agaffe susdgaffe,sptovocasnness rdsemvocasnne. Quiebâaie tnrv dsdlibrtéésupee ii el,dvioltalséarossiééddpsivéd,ocom lsc8217;avtsppseacas ac llsne voiin(&limiongphl,l#dCdoco, l brong class="spip">JIAderéeMornostrong>&/e[3].IRéacon ( rcéviinbll,r csdcieonseseievdséncientJ#rsRru scewuradr d Nne. Ts le csdcieonsesert&ot é le santue séeocilsesrso dontrc,unéDbsp;: C&rallumlntar d ,djugep,dcom lrça n ,dr yss l,rourrrdup,dchôms rn,setc.LTs leassdnunpaa euarolsrewuradé on sdnenech82339;ur csdaorfa pu ,sdduabrong class="spip">JICneiilenÉlectorlsoPseianesestrong>&/,oduabrong class="spip">JICneiilenSupéi r rudu Pwuvr lJudiciar dstrong>&/J(CSPJ),cdpc#aacor uptionretsducgaip"ieage des deniirs ree ics qii i8217;avé lerntJàcv tdl8217;an82339;i br> sbr> sL édialporl as ésodeueàdc ttcflevéddesabtueeiselecc ld# émanrlscoasnneste usrls mtrcredi 26éseptbre ,0nevantae rbrong class="spip">JIBrooklynICoiesgdstrong>&/Jà New-York. Lpsemanrlscoasnnemssonpaa eureuveursuequai au&#eoaeareuplsa éumtirécsafconfiaec,ae ivenrnlent.,. Ls leuplsaouvr,agai e le dd uxdbraloetéomp snceaàeexi,ulesne déiarteewuretivever samdilivtarc,.pCre&#edd8217;anx i amaéraeuise t rsue s slogans#171;nbsp;?LDilivte loueseadésesorrbsp;:»M. br> sLelivenrnlent.,a o&place n8217;avtsppia aàslséhaué, leessedéfiludse#8217;anheur,.pSesdmbre ,sdsddcmppor,, nsomp sudsevulgsis,sépstrpsaursicie lsesaesentrscrue.caetruo t #es seulesdrréoccupionnesnntrsesorntJàcs8217;anxmuser, àeboire, àeaornie traetJàcnt r l#es carnsvass.aDa luaavcsiss éet ome&#eaetJinrne,iè léent rnaonnelrl ecoulaes,uoùé#esrgvenrnlent.,le#dsds ys&dnelte lsemènenpaneespolctce tdl8217;anx stésaéé,alelivenrnlent.,ahaïtruesaugmlnt,ass lenrngognrv danore ,e#dsdin(ursseDort&por,,fe rleqdNmasattéi rlsrcmnfnéseàadpsentpoass. br> sSura dCulae dpc#aaivenrnlt cl,uc8217;avtspps8217;ÉOimbrogeio dpc#aatéméi ,é0cc lddix-hii sMasattseDort&vingtpSec é lr dsàd8217;anÉtttde ivenrnlent.,rbrong class="spip">JIMsrpelly/Lamothdstrong>&/J(si t enétstal&drarilnt,-hii smbre ,s)éurorleqi8217;Éii é#8217;avyase&avoiMéqiravangt-septosouseneliiudreJIPcéval/Beslddfvdstrong>&/tee 2009,avangt-quai ausouseJIPcéval/Preras-Louisstrong>&/tee 2008,avangt-rivisnsouseneliiudreJIPcéval/Altxesstrong>&/tee 2006. L8217;ÉOinntrscrue.catrimpph,0cc ldcl cabinetNmasattéi rl&drarilnt,-hii smbre ,spewuranec=urpulssnnesdeé9,9 maieionsàd8217;anhrlntt ts, ta dis qiralelivenrnlent.,aftarçaileaarilnt,-quai aumbre ,sddi igea tane&p ys&de 65 maieionsàd8217;anhrlntt ts br> sbr> sbrong class="spip">JISupéi saééeJIkrizokalstrong>&/tesauolctce tdluvcsachatbtrong>&/ br> sbr> A xeÉttts-Unis, lssutenent MrJIObamastrong>&/ossoposu d sreuirree#8217;anu(&Miirs lssdificitcpee icpdcfquatorze maiee-maieiardsvdetdoiears,asi t dcfquatre maiee-maieiardsvdetdoiearsss rd12ns leetéomuper SabudgetJiédérascursdn1512vdet38 maieiardsvdetdoiears.LEopFrt cl,uft, audutenent MrSarkozycq i&an onçtrpt#elieenddsNsalsis,sédudutenent Mrdpc#aaRépee ii ecrt&drsRmasattseDojtiqi8217;Éiee 2016,essrsct curae MrFrt çvisnHoiea de es, allénelusnloid epaaossoposé,se8217;ÉOi atsppéludutenent M, d sreuirree#dC30% #es salsis,sédudutenent Mrrt&drsRmasattseD.IL écesus,uasé tsadopté,ae utecreracneiilenddsNmasattseDodeseoneq ini enelt cé17emain1512.sbr> sEopHaïtr,lc8217;avtspps éuolctce tdluvgaip"ieage qii rré#omend.ILS utenent MrJIDa ilo Medinistrong>&/,odpc#aaRépee ii ec#omen caind, v t., envviinteeeux NaonnescUnirscà New York0cc lduneseélég on (odeseeptombre ,sd[4], ta dis qiralaseélég on (ohaïtruendentedirpe&rsue s utenent Mrbrong class="spip">JIMsrpellystrong>&/tcmpptg q auasec-ciniombre ,sd[5].ICofeasirent.,&àalaseélég on (o#omen caind, c ttcfeélég on (otsppntmposée #ddcmppar"eDort&d8217;iaéléme ts trl#dnt nraséigdifiaess qiralelur er l#8217;avupia auugé niabciir dodpc#esdint Mifi r. Siras nt /bsp;:&!oPscctdileqaouecas rsdetblsbsp;:&?IC8217;est pabizar au&#i e me l.aOn neécoppssdepia acepaachanlent.,aàcseasurpasnpr da luaavbêtatd.ICea éne r ssrreeq-p-lleia aàse cfanltqusrewuraue.tissur #dsdJIptrddiemsti>,aneeseCcroe trievqial#luve spasp r doso anorbsp;:&?IUne manrèrqninntrscrue,,ad8217;anaffichdue éssopu/deodJauvgaip"ieagebsp;: ? br> sL ébtueee es, btueeéuprsuebrong class="spip">JIEdwid Zuenystrong>&/,ou(&séelte ledueu rtioutenent Mirl, qii crae Jauvvcssgesdueuuglpbrong class="spip">JIBob Simonesstrong>&/tee l i&cetimanpt#8217;iaord dodpcsralasbtueeer [6].ISaesnot rnerneutt ledueuot,a o&roulant r dorednsnleemsgesmulâtresoraet revtddie tranees#171;nbsp;?Lsupéi saééekrizokalbsp;:»M,d#8217;ioagrecie leardiamraébsp;: C«nbsp;?LTuc oiscrespecte aneémulâtrd, Edo Zuenyétesntentît,cmailerac lssséelte leZuenydLJtus isNbedn ,ert&otiptuedsdnègre [7].bsp;:»MeC8217;est paosé,secandaleuxertvexp osif.IL éomupertsppiueineécc ldunlivenrnlent.,aq i&apsèsd16emoisaaurur er ltsppréjà émaaieé deamésave msseDolq duneseru dNréutehu/delmsslaaee csdx i am.IL ébarbarieledo#aasauvagtrievso taaux ntmmn des0cc ldunesflagai tepubsencusdddlucidaéd. br> sbr> sbrong class="spip">JILeépstrplassnaaurur er btrong>&/ br> sbr> Leéecandalertsppiarot se/nqii e i a#e l8217;avtsppia ,lc8217;avtsppseam lai e. L8217;ÉOénhecedueustrplassnaaurur er v t., envesué utecreralir cdeseoneieexpéi rnceapolctce tdetsduccmppor,,msntéaberao.,anueutenent Mrntrsesoa Méàeagirsomp susiéot sdépenat padesaui e/nqi8217;ÉOi é#8217;avexesoartPilpt#8217;iaiestituénnedt# saolssu ys. Ays /sé tsedtapultddaurur er rsuee cfnmmiele Meent rnaonnelrlse xeaboisrq iàfuya nsomp sua eusstse#e regimupent., masna adreJIIdiéé-Pcévalstrong>&/,clqeustrplassnaaurur er #8217;avupia acmppsiluaaee csdtemploo donhangé tté&#esaeéutenent Mrdpc#aaRépee ii ecne re sru dNflirqnàssaaiui e. Ss leqi8217;Éiarcunesloil#lusorplvoté,ae Pallumlnt,ert&uvantrie lsqi8217;Éiu(&utecreramasattseusorplappivevé,alelivenrnlent.,aMsrpellyna imposéee cftaxe (rtenenéél com lsneesrenevanc )ad8217;Éiu(&mnetantadeo$1.50éssdn#eémnetantadeocha&#s riansfrtéed8217;ÉOurgt.,ereçuauetHaïtrCetruqe5cnenesss rdcha&#s ureescléléphonie tpvirs Haïtr.ICe dmesus,séso taillég lel,cna #8217;avuys /sjamaileé tsraMifiées0cca.,eoueapsèsdls rdiqs/ envvigus rds uee cfloi esainrne,am.IC8217;est par tc un&vol psepéoréecofease#esdrlusnsauv ls, un&vol pcdtiq é rsuee cfn ii ec#o t #es mbre ,sdsddcmppor,, nsomp sudssrgangsters qiiuo.,efa pamitsabassedsuue 8217;iaÉttt. br> sL én ii ecaurur er #8217;avupia aaelryséa# eeiouaonne #se#8217;anussrreeéea égislrifvdpntmposée uedmajosaéddddsdépuéésufrauduleusunt., élui. Com ls#dCdrpt#8217;iaJIOrnisat on (udu PeuplsauedL té strong>&/J(OPL) d saosa elrnrèrqnAdrrcirdàe# énlonne, c ttcfussrreeéea égislrifvdpregimupes#171;nbsp;?Lneesflopéec#8217;iaélusnissusnl8217;ioéltesineserréutogaimméel,clq dru dNrocambo#psqllludse#8217;anhnltor d depccsvrilnt, elrnrèrqdNxenéss,psousea8217;anurlntragesecandaleuxededjugep électore xevéelux.bsp;:»MeLeépstrplassnaaurur er aaos#g cé têé abtissée da luaaver s ria éuprsuesesdrrédiabcie ls.LEopayant r nmurscàe 8217;ÉOuchttRessnvotele#dsds llumlntar d afie qirac scdprnir1snvotenteewureeonePtecreramasattse, i as8217;avesppeofoncé d saolsspiègqninf rnalcdpc#aacor uption.IDranosaursrl,clq ddépuéésueesseéve de dorac mailesraloud taelutôt, l8217;ÉOespaclcd8217;Éiu(&votevetrme lsiaseneliiud8217;iaunes égislriur,. br> sNee#asrsia dorac de r ssrsrc scinrne,iè lspewuraae te aiedéfietmtntJ#rsRvoteleniabciir dc ewurapasnpr #es moideresnlois,ae rur er lexursiffscreusuucha&#s jwureeaeesmbeoetéomp snceaàeenscreusureewureeesmcmlluborlte lseddc ewuvoi1s égislriffcrt&judiciar d.ISa elrnrèrqndiaouvsetruasé tslra mnmursce xear acoasnnemsurlntrarres&drarilnt,-sixdpsel tnalitéserulctce tsu#o t #es avocasseJINewotnrStdLJticistrong>&/tesabrong class="spip">JIAderéeMichdlstrong>&/.IL étectsonvruasivor tsgrâcrdàe# értesitudeéduccmpmiciir dod ivenrnlent.,rbrong class="spip">JIan SRenescSéeltusstrong>&/tq i&apu yéPnheracepaacte #ddcmurage. Lpseéltesineserwura dCr oenrl#dnt nr#ueSéeltP#8217;avo /nrac euélir ce xeiahét clscinxéeDodeseor,,eqiraleéutenent MrMsrpellyn#8217;avupia apasné lsstest f uamlntalcdpc#aadémoccdtidrq iàft padu&chef dee 8217;iaÉtttaleliaao.,anuefonconnenent nrnoimaenddsNiestituénned. br> sbr> sbrong class="spip">JILeéivenrnlent.,aMsrpelly,essrsarossscuendmibtrong>&/ br> sbr> Ayant prpeusunt., échoué,clqeustrplassnaaurur er es, audbo vnudrou cau. L8217;ÉOopiostonne démoccdtiq el8217;avupilacé nevantaeneraet rnaonvtbsp;;:C&dilivte loueiartir.aDa luaeautecreracac de figure,alelivenrnlent.,aabandneners mssaslogce tdls jr cà eommlenégaonvt,vds lea qlla ot se rmtrddJpsed audmuissau(e&rsuMiidd tnadiqs/,pewuraneégai e jr cà eommleiostonv,uoùéot se rmtrddJgagd bsp;;:C&laéutenent .c, l,sépartise#8217;ioopiostonne,olssu yséot st Mirr.aDa luaeas ntedacac de figure,alelivenrnlent.,alii-me lsie seontreuseaeae te auet#éiqsonsrni t. C8217;avtsppseachoixeqi8217;Éioe,efa p,ac scdprnir1sntempl,cbrong class="spip">JISilvio Beru dnteistrong>&/tee Italietesabrong class="spip">JIGeorge Papaderéoustrong>&/tee Grèc,.pQii e #8217;iotxursiffsne re sru dNcor oppss0cc lddesdenvelopiesdbo r é led8217;iaurgt.,,ri anoi/ne aefddrc=àe 8217;ÉOévent .cbsp;;:C&laéusuMiidtsppoermasé,. br> sSigd ddesdtempl,cla=urpulssnnesdesdCay seardijàemanrlscoéseoneieeifféneccléft, àel8217;ÉOurgt.,emnvoyécrwura ancor oppss. Hitr,dc8217;avéts msc lle du Cap-Hltcisnuqii,ale 27éseptbre ,01512,pdtentipaa eureuveue tderued eév eului. Com ls#8217;ÉOénsaérJIDalynValetstrong>&/o# saol8217;ÉOédrposaaendu 28 septbre ,01512,p#171;nbsp;?LL8217;ÉOénheceau Cap-Hlïtruesdpc#aa"tactiq ep qmcenvelopiesd" n8217;avtsppx i au’anu(&cantufletJàctousene xeqiiocrore M, envesué eppiarot ,ce xersetudNxetsphenes /dsert&uphro#asiaqllludse#8217;anurgt.,e[8].bsp;:»Msbr> sLs utenent Mrdpc#aaRépee ii ecrstaaujr r#8217;iahui&a eurce,ipele viconme dpc#aaiuer au’anllecrdiamraérdàe# éscciééddhaïtruend. Guer audue irseéncieme t carnsvaspsqlltq i&apssdn#eéctup urearem sntéréusonvmaileqii,a o&fa p,aa prpeusunt., échoué. Ac ld#pseéléme ts uedmajosaéddss leic upulltq i&ldpntmpose.,,alllivenrnlent.,aMsrpellynrstassrsarossscuendmi.IPwur bciiypr depsortiledueuéori ,ri anoi/nomp sncerds uerésesorraàcsessarossss relan ( destauctri,am.IPwurquoip#8217;iotx-masattseudpc#aaJticc.cabrong class="spip">JIJos é Preras-Louistrong>&/Do(ctenuerwura dCosimeed8217;iaur acoasnnecd8217;Éiu(&s llumlntar dcer&aonconne)ninnrpe-p-lleleccmpmiciir doan SRenescSéeltusaàeenvoyerneu cabinetNdueuuglp#8217;iaiestauction ursrt-au-Prince, l#dCdosonpr depmanrpulssnnesdesdf us&pee ics pardMauaml&laéutenent treJISophiaISaint-Rémy Msrpellystrong>&/bsp;: ? br> sQilaéns se rmtbiseacaahé depccttcfucsnnesterrifiaesebsp;:&?IUnaacte ve geur bxercé frtident.,bsp;:&?ILedmuissaqi8217;Éioe&pu ssemdire, c8217;avtspp’anllei atxesorabruesaucseie #u ur er u(e&éq ipeed8217;iaurtiss ledu&chaom.IPa adoxa cme t,on8217;est pao &me lsJos é Preras-Louiseqiraleéutenent MrMsrpellynaenmmié utenent Mrdpcssrsbrong class="spip">JICneiilenElectorlsoPseianesestrong>&/.IUne x i auaorfa pu ,. L8217;ÉOave es, sore ,.pCre&#ed#es rselptesivrscecoulaesssuttm(ttc., o&fa pudpc#armescrt&drasrsffra clsceesssustitàrllirqnàspsel tnr.aDa luaeabralode fer qipdse jr ea otreelplivenrnlent.,aMsrpellynrtul8217;ÉOopiostonne démoccdtiq ,sa éeéot bqadueuwuvoi1pne re sêi aunic#aadémagogissnic#aarhéposaq . Leéutenent MrMsrpellynnoi/ne8217;ÉOinnliner. LpserevtddicaonneledueusuplsahaïtruedsonpaaégionmesPetruoive msêeasesatatfa pds. br> sbr> p>

LL[1]dbrong class="spip">JIJohn Lockestrong>&/,dJITstitéod ivenrnlent.,rc eilsti>r(1690),cUnirselttéod Québec àsChicoutrmi,eCxeada, 2002,pp. 139. br> s[2]dbrong class="spip">JIAmélie Baronstrong>&/,d#171;nbsp;?LHlïtrbsp;;:C&laécolèruCcofease#eluwuvoi1pgagd srt-au-Prince, bsp;:»M,dJIRFIsti>,a1er octoe ,01512. br> s[3]dbrong class="spip">JIAderéeMornostrong>&/,p#171;nbsp;?LL(ttreroursetrue Ptenent MrMichdlsJosephrMsrpellybsp;:»M,dJILd Nnenrl#iicisti>,a21 septbre ,01512 br> s[4]IL éeélég on (o#omen caindaaccompagdantae rutenent MrDa ilo Mediniéenr o éotusuueux NaonnescUnirscéts msctmposée #ddC lloseMorlsesrTng>coso (Masattseudps Affarres&Ériangè ls)bsp;:&; Gticavo Mnetalvo (Masattseudpd# éPtenent .c)bsp;:&; JoséeRamónoPseaeta (Masattseudps Affarres&admasattsasivrscutenent Mirllls)bsp;:&; Robrtéo RodriguszrMsrchdnié(Dirtes, l&deaa éCmmielicaonne)bsp;:&; Migusl Mercsddcé(Dirtes, l&adjrnsted Déiarteme tad8217;iaIevdséng on (oNaonnelrl)bsp;:&; C llosePa edoPseszr(acinsoa Méd Dirtes, l&adjrnsted Déiarteme tad8217;iaIevdséng on (oNaonnelrl)eete SaGenersl AuamsdCacerrc Silvettse, chef dee aliaadeeiniitir ddutenent Mirlll). br> s[5] Haïtr/Naonnes-Unirsbsp;;:C&Une eélég on (odes45 mbre ,sdaccompagdersaMsrpellynrtuLamothddàe# é67eusecin eddd#8217;anussrreeéeagénérles,uJIAlé Pcmsnpsti>,a25 septbre ,01512. br> s[6]dbrong class="spip">JIThoias Pérletestrong>&/,p#171;nbsp;?LU(&séelte lecrae Jauvvcssgesd8217;Éiu(&uuglbsp;:»M,dJIHaïtrCLibrtéésti>,a18 Septbre ,01512. Vr aausonvbrong class="spip">JIWaet rdCameaustrong>&/,p#171;nbsp;?LL(euuglpBob Simones huai iddrsue s Séelte leEdo Zuenybsp;:»M,dJILd M onnsti>,a10éseptbre ,01502 br> s[7]dbrong class="spip">JIThoias Pérletestrong>&/,pJIop. nrpsti>. br> s[8]dbrong class="spip">JIDalynValetstrong>&/,p#171;nbsp;?LL(euwuvoi1pomp suhiboubsp;:»M,dJILd M onnsti>,a28 septbre ,01512p>

L />p class="spip">LLrt-au-Prince, ,a2 octoe ,01102 br> sbr> p>

JISmnmussssbsp;:&!sth3>p class="spip">LLPalbrong class="spip">JIeDalynValetstrong>&/ br> sbaRhref="http://www. cmaonnhltci.omp/"lass="spip">_out">http://www. cmaonnhltci.omp/p>

LLLssu yséséaeim.aDuscreuxce xersni am.ILesRru sce8217;esenflam snt.fbrong class="spip">JILsvass=strong>&/tesaal#iéscàe 8217;ÉOheur,eddd#8217;anucsnnesiniiti treoursetrue Mi-MsrpellynnudNordràe 8217;ÉOO elo.IL égai ecfmanrlscoasnnesderru CiursdNmaieisele#dfcapois,ajeudi 27éseptbre ,,Ccofease#eluwuvoi1pbrong class="spip">JITèt Kaldstrong>&/s#s ledité&#esaeéutenent Mrbrong class="spip">JIMsrpellystrong>&/ta&ot é le sastis (svdede8217;ÉOinqipéter. Il yaapptovocasnneset raidncieme t ddc ewiionnescee&rsuMdetad8217;ana i a.ILesRsmnmusssserulctce tsuetJeéo ii eloeocilsesrdrac scdprnir1snursrluo.,efissuréejtiqi8217;Éie xefodettn (svde # emtis (aMsrpelly. Rrued eéserasru dNcop succa.,.IAu urnstedpcsraurmn der onvclt édificeerésesorraeàadpsemnuvrme ts denoabiltsl ts répéttonfsPetruustlmssl&drarièsdaortcfmagnitude.IL éctis (ae paàureer ,areatauctuseroetéomeiolider # saol8217;ÉOimmédiac. Bn csesecndu,ssicsessayants doi s tnne.antéào#aasauveiaader. br> sbr> sM.bsp;:&Msrpellyns8217;avesppcsdnssdn#eédos,c# saol8217;ÉOimptunt .c nmmriur,ledo#8217;iaiesolt cladésenvoltc,ets le csdstes, lslvébluxeded évie&naonnelrl.aD8217;ÉOimporoa.,Dohop ssad8217;anaffarres&etdx i amamodestqmcentreas ns rn,srépuéésubnesnnieonses,adrsue s nhantagecfiscal.ILesRnatégorn séeocio-rrmcecin nlaesssévoluéss,prsuee =urpulttmeebrouaie t&etdhauéaie qiimdivaludLa éntrntissae.caetrfa pudpc#aéntrrtonneemodestqadpsehop ssart&drsRfep ssaéduquéao#qs css="eDomonsenesau(&motif d8217;anhuai iasnnespee ii e.IL éoss="e&sulctce t,rrsue s rureescce, sst tedecsessfa lmss"eDort&decsesstaseDort&psue a polctce tdl8217;antxcluinneset stesaresoraewursirvie&ssue s ur er aaumditrint nr#laot scr q pdn8217;avtsppia aursct rseén rose.IL éutrcirdrt&#rsRdémoccdtss,prsue#8217;iaiesultc=useianesecnrt&psue a pr rue 8217;esengfddrc.,rcesdrrmcédésdx iosaéarres&anae ronie ts qiiute de doàNflirqnddsNiestituénnedeeutt omescetciedérsdet /lludse#8217;anÉtttdess ureeddicrsRdévoyésee Palai dnaonnelr.IUnuvra s mnmrdrewuraneéur er as saoacinseoeocilse,apolctce tdetsiestituénnenlaes. Washangtneset a brong class="spip">JIMinticahstrong>&/s#esssustie msêease#es seulsliaao.,sc#8217;anu(&eegnmee moot bllmséenr oucieux&esarésultass ea luaavnoabilt Meent rnl.aD8217;ÉOaaies rnsnu é#8217;aventrevi s aneéave oùé essdcasqlllubleusudse#8217;anOnueseam(ttstie msà tnrrraàchaué, lee8217;anhop ssas leesseémeutisele#dflséaeimrewuradéffddrc=neéur er aqii i8217;avtsppréaégionménd saol8217;ÉOxmlte lttmeeianagésaaenenr o inefficactté rstesecnàs ésodess0cdéquatent.,éenr saobluff luxedemn des0rrpulsis,s br> sbr> sL sasévocasnnesert&oiansfrtéaoabuinfsPopérés&ssue s ur er ad saol8217;ÉOxreareil&judiciar d,ac scmuoasnnemsu saolssvntmmn dent.,Dorulc.isele#éiarteme tauxertvcpseremplaceme ts d saolssveélég on (sce xefinle#dfmateraceptesrébeieionvdesRru scetad8217;aneddiiuere ént éscoasnneseocilsedligdlsed#8217;iotmbarrasudse#8217;anéq ipeeTèt Kald àebn csc,undue csdcmrdtenéesdrrmf uele#dflsécsiss. L8217;ÉOimprérsrlonnevdesRunsart&drsRx i amaàoaciumpr dephaué,s&aonconnesàd8217;anÉtttdnrreeqassdn#eéurnstedpccoûterarièsdnheraàc#aaRépee ii ecaudme lstii au&#eoaeu lircaplcaéddàddnenerndesRrésultass ea luessedélai dstis (ntlmsslaltmlntde#8217;aniesurssaédvdesRru scetac lle desersni amart&drsRmoosaés br> sbr> sQii e #ssu ysériamrmqadueuai ,rrevtddie taurschangdnt nr#lapolctce tdetsdemdireconne,olssivenrnlent.,r ésodeérsuedesdchangdnt nsNieopinés ee8217;anhop ssaesél édistribusnnesderrstrpqmcenvelopiesde xe" têé scee&ro.,e"edesdzontsNrépuééesdchaunts. L8217;ÉOacsnnescmlltesivraesél élogce tdls # emobiltsltionvpolctce tdnrreeqnt r lev eàduemtrcenarea, mnenayablsrewuralls&offic rlsrauxdbrac lesseroses. L8217;ÉOénheceau Cap-Hlïtruesdpc#aa" tactiq ep qmcenvelopiesd" n8217;avtsppx i au’anu(&cantufletJàctousene xeqiiocrore M, envesué eppiarot ,ce xersetudNxetsphenes /dsert&uphro#asiaqllludse#8217;anurgt., br> sbr> sDimanchcC30éseptbre ,, l,séiniiti ts Lsvass=rrt&drsRmaieisele#8217;anx i amamécnetc.,luo.,eeievdsénpseam cauamrewurarureeserneuxspetschnltesdls rdctup d8217;anÉtttde8217;anlleyaap21ns l.IUne façodJausonvewuraceasees, l&dearureeserneuéutenent MrMsrpellyni ecn8217;avo /nrac é Meoue id le saaccointa clscdreJISweeMrMickystrong>&/,o#8217;anurtesoraewpulsis,,0cc ldJISweeMrMickystrong>&/,o#eeiniitir dduetschnlte.ILesRTitidruesdiedéciotttlmssle8217;esen& ouvnne.antéie lsqii e #ssu yséanot rné&laéusgcnrt&penchcCrselelaa oenrl#dtHaïtrCà édifier ouralls&diaore ,sddepclcu yséqi8217;Éioe,edémaetclé,apaieé e,aabandnenénd saol8217;ÉOieeigt clacrasnpe sasécesecseélrpqmcivenrnlt /ds.LD8217;ÉOaaies rn,aot é lessoporonnesàiaadéel,clqebnlae dpsvxenéss Titidcrstaausonvsore , qirac i #dsdxenéss petschnltes. L8217;ÉOu(&sereeqaêease#8217;anore , ewréds,cmédiocceoetéoarecriurlrl dddl8217;ana i a.IÉventp snt,aomp sua ecalamrpeusu=useformancusdddJIPcévalstrong>&/ta&enfanédaMsrpelly,e#8217;iaiesoue ntb dCosétasatm,eddd#8217;anucsusl ur er asrreeqassdn#eéurnstedpc#s leréievdntdueLsvass=.IPwur ls mtaies r. Ouerwura dCpird br> sbr> sL égaognrvgagd squasint.,rot é le saségineledueu ys. LesRguesdtnrr /nrsét x,,adraesué uwuraoccuperJ#rsRru scetéorae r da luaavcolèruCls rdras-le-bolbsp;;:C&e rté dea#anvie, sentime tad8217;iaubandnead saol8217;ÉOxrrrèrq-u ys,acor uptionrsupposétdls # eaelaiesdutenent Mirlll,cgaip"ieage da luaeaivenrnlent.,,mditt rneme ts ut eeellocasnneseillég lelode f us&pee ics,rno(&respect desdrctmss"eDoélectorelss,psoupç (svde nrl#éitésertenent Mirlllsdx iosaéarnltesdpsue a vs="alttasnnesd8217;iaiestituénnedtiedérsdet /llucom ls#dCbrong class="spip">JICEPstrong>&/tesaadCbrong class="spip">JICSPstrong>&/J,&oiansfrtéaoillég uxededjugep,setc.LL élesoraes seg>&ud depccsvgriefserete usdpsue a tdmécnetc.,uCcofeaseM.bsp;:&Msrpellynenr o #171;nbsp;?Léq ipebsp;:»M. br> sbr> sLs Palai dnaonnelr #8217;avupia aas"ezedpccordamaào o arctq i&l8217;anhabilt estie msà calmeroetérenverseraceptesvapr rueocilsedmnetanteoetébrûlant,.pCar,éft, àenec=urpulssnnesdeéru dNe(&rlusnimpatre M,,0cfaelécaetrfurieusupeo utis (adedrctmss"eDoélectorelsserosesrno(&te uss,ae rur er l#8217;avupia adrasrluénnedtmiraelts qiiusoulagestie msl élne,ilt /dpcsdèrqnddsNtriiesd# saol8217;ÉOimmédiac. L éeéot bqaaumdrrmqahaïtruedtenent ea luesserulctce tsupee ii el patremnt., éluboréescetciepelligtmnt., txursiéam.ILesRvra séeoluénnedtne re ve msseadéployerne tdnura dCeg>&poerme. C8217;avtsppsàeqiraleéutenent MrMsrpellyntsppjticint nspiégé.IL éurpulssnnesl i&apenlevé,pbrutalqmsntéetébrtiqisme M, envseulemsnté16emoisadearègne,aàe# éao s cébénéficeedue t raetNdueeg>&poerme. Eaes neél i&apltissé,mdrrmdtiq mese,sqilsl8217;ÉOinntraorttb dCoe ig on (odesgérersl8217;ÉOurgt clad saol8217;ÉOefficactté enr#laot stenouess0vitevetrmitse nt s. Sneemadettaàe# éao s envjr cepa o i elonne br> sbr> sDa luaavdoi s olrgd ddeanosaéraeisineserwlctce ts,sa étectsono(urouraltcaêeaseaortcfe z céPtenent Mredpcsramofeasdnsuffrsa M,étêéu nrt&plusnhop seaortneuxsgriffls&diployéeseqiraChef d8217;anÉtttdviin narreledohumanrstc=àe 8217;ÉOéct raesassrsaeuplsa uxedenentrataohumaassr g>&templonégligés. A i ant., eit,ae rur er lomp sussrsarossscfossoyeuroetéhiboue#dfmalhe ls.LCeaseraien oublent.,r egietétb d. Regietétb deewureeonemadettartenent Mirlamortrl#dnt nrattenstedpc#ssam ladidsNiefanéilesvepa oterré utemriurént.,. Ls lrmceciupt#8217;iaiestituénnenalttasnnesdémoccdtiq epâtnr égai ecnt nr#laot qerupiur,lbrutalqcetéohaotce tdluvq ini enelt rtenent Mirl.IUnutrl spectreae paàuconjuser. Si, da luaeajudiciar d,al8217;ÉOxh lttst teecandalerSano(-Séeltusaécsistallaslaa8217;ÉOipaloin edddc,lbric-à-bracaqi8217;Éioe&nop sucbuinvrme t o#171;nbsp;?Ll8217;anéq ipeeMsrpellybsp;:»M,dlsserisi eloeo t obruedterlsrd8217;iaunesdenoabiltslon ( rcovoqué,adueuwuvoi1ppsue a tdemsore stréuprsuesesdadversir dc ewlctce tsuimpatre Msvepafruitrés.L Enfie, c aseraiensurot sregietétb deewurene&p ys& uxecsdèrqs psepéoulaess.IUne HaïtrCqiiusubi/ne nmusssseapsèsde nmussss.L Etnd saol8217;ÉOiefiets mnmp sncemt., br> sbrong class="spip">JID.V.strong>&/ br> p>

L />p class="spip">LLrt-au-Prince, ,aaoût01512 br> sbr> br> br> br> p>

JIFONDATION ROGER GAILLARDsth3>p h3lass="spip">JIAPPEL A CANDIDATURES -01512p>h3>p h3lass="spip">JI BwursdCdocoorelsauetHnltor d cnetcmporaindaaaaaaaaaaaap>h3>p h3lass="spip">JI ------p>h3>p h3lass="spip">JI10è suértonneedu Cg>couele#8217;anexctllt clsth3>p class="spip">LLApsèsdeneraenést#8217;iaieterruptionrd ecaud éismledu 12 janvrera1510neu couele#uqilaé a brong class="spip">JIFodettn ( Ro,uleGaaieaadstrong>&/ta&psedu un&decsessmbre ,sdfodetts rn,abrong class="spip">JIMiohaeGaaieaadstrong>&/tetaenerdecsesslaurédtss,pbrong class="spip">JIRose-NicmlltpCadetstrong>&/,p a FORGa éumpsilutee 2011 essrsct cmurscennuqee#8217;anexctllt cltee hnltor d cnetcmporainda#8217;anHaïtr.ILCeptesiettisonvruel&lit.,rot ursrluenmcmlluborltn eec ld#a brong class="spip">JIScciééddHaïtruende#8217;anHnltor dstrong>&/tesaadCbrong class="spip">JIRectorenr#laa8217;iaUnirselttéod8217;iaEtttde8217;anHaïtrstrong>&/tesarl#dtbénéficid,ocom lsdrariaeisine,eddd#8217;anuppiiudre a brong class="spip">JIFOKALstrong>&/. br> sbr> Afie #dddynamatdua# érteherche suue 8217;iahnltor d depnotrlcu ys,ae rlaurédttbénéficidsdenormaisrd8217;iaunesbwursdCd8217;avétuessedoctorelss,pd s o#171;nbsp;?Luesaet rnae, bsp;:»M,dot ursrluinrne,ée&ssue s brong class="spip">JIivenrnlent.,aftarçailstrong>&/.IL ébwursdCtsppr8217;iaunesdurétdls 18 (dix-hii )emoisarérsrtsdnssdn#esérivisnxenéss #8217;iaiescsiptionrenedoctoretnd saound e irselttéoftarçaile. Eaes omp sncera envjanvrera1513eewureeepoermaseraàc#aafie #ddl8217;ÉOxenést1515. br> sbr> p>

LLbrong class="spip">JIMODALITES DE CANDIDATUREstrong>&/p>

LLbrong class="spip">JIdJICRITERES D8217;ÉOADMISSIBILITEsti>bsp;;:Cbtrong>&/ br> sbr> p>

LLbimg src="local/caahe-vrgd ptes/L8xH11/puce-68c92.gif" width='8' height='11' saet="-" style='height:11px;width:8px;'lass="s'' />bsp;;:Ausnont., eumdipô, eumdosonpr depcandidaouse,rêe létitullirqn#8217;anu(&Masorra2auetHnltor d cnetcmporaindbsp;:&; br> sbr> />bimg src="local/caahe-vrgd ptes/L8xH11/puce-68c92.gif" width='8' height='11' saet="-" style='height:11px;width:8px;'lass="s'' />bsp;;:Etss0cdm s envdoctoretnd saound e irselttéoftarçailebsp;:&; br> sbr> />bimg src="local/caahe-vrgd ptes/L8xH11/puce-68c92.gif" width='8' height='11' saet="-" style='height:11px;width:8px;'lass="s'' />bsp;;:Etss0engagénd saound rteherche relevantadumdomaindedeé 8217;iahnltor d cnetcmporainda#8217;anHaïtrbsp;:&; br> sbr> />bimg src="local/caahe-vrgd ptes/L8xH11/puce-68c92.gif" width='8' height='11' saet="-" style='height:11px;width:8px;'lass="s'' />bsp;;:Etss0de&naonnelriéddhaïtruendbsp;:&; br> sbr> />bimg src="local/caahe-vrgd ptes/L8xH11/puce-68c92.gif" width='8' height='11' saet="-" style='height:11px;width:8px;'lass="s'' />bsp;;:RenentrauetHaïtr. br> sbr> p>

LLbrong class="spip">JI PROCÉDURE DE CANDIDATUREstrong>&/ br> sbr> p>

LLLesRnandidaosadevro t impésasivrnt.,roiansm(ttrera8217;iannnrreeqadesddocumeses suiva.,Dorsuecmurrrdu électronie tbsp;;:C br> sbr> />bimg src="local/caahe-vrgd ptes/L8xH11/puce-68c92.gif" width='8' height='11' saet="-" style='height:11px;width:8px;'lass="s'' />bsp;;:UetPnurrrculumlvébleécoppssdantJ#rsRielormasinesersel tnrlllsd(adrrcirdpostlse,acmurrrdl,cléléphone,letc.),dlssernnnrrgd meses cauéme&#es (lormasine,&pee icasineseéve msrlllsdoudcmmielicaonnel) aassirqilsptofecin nlas (lonconnesàoccupéel,caesivaééseéve msrlllnt.,rbénévolel,cetc.) ereieeiqii t,vewuracettcfelrnrèrqnrubriq ,sallucomrdtenéesdddsNiestituénnedentrc,uné,s br> sbr> />bimg src="local/caahe-vrgd ptes/L8xH11/puce-68c92.gif" width='8' height='11' saet="-" style='height:11px;width:8px;'lass="s'' />bsp;;:Ueralettss0de&motivlonne. br> sbr> />bimg src="local/caahe-vrgd ptes/L8xH11/puce-68c92.gif" width='8' height='11' saet="-" style='height:11px;width:8px;'lass="s'' />bsp;;:Ue t x,,acmurtéutenentantae ruttjesadearteherchebsp;;:C&2aàc5éusgcsam ximumlinnluantJ#rsRréfénec, s bie iogaiphce tsuetJlesdf us&d8217;iaurchivrscsusctptilms du8217;iaêe lécoppulséDbsp;: ; br> sbr> />bimg src="local/caahe-vrgd ptes/L8xH11/puce-68c92.gif" width='8' height='11' saet="-" style='height:11px;width:8px;'lass="s'' />bsp;;:Une xtéscoasnnesdue irtes, l&desaérav uxededdoctoretnau titss0de&ptofeci, l&deaa8217;anu(irselttéoftarçaile (oùé#eRnandidaocrstaadm s)bsp;: ; br> sbr> />bimg src="local/caahe-vrgd ptes/L8xH11/puce-68c92.gif" width='8' height='11' saet="-" style='height:11px;width:8px;'lass="s'' />bsp;;:De xelettssc de r ntmmn dasnnesd8217;iannnrrgdant/nhercheur(s)ad8217;Éiu(irselttésdhaïtruends,u#o t c lle d8217;Éiu(&stofeci, l/nhercheurle8217;esengagea Méàesuiv ,0igalqmsntélesaérav uxeduRnandidao.p>

LLbilass="spip">LLAUCUN DOSSIER INCOMPLET NE SERA ACCEPTEsti>. br> saaaaaLesRnandidaosarete usdpe ve msêe léconvré aàse centretruesac ld#pdjuryrdecséltesine. br> p>

JIDATE LIMITE DE DÉPÔT DE CANDIDATUREbsp;;:C&30 octoe ,01512sth3>p class="spip">LLEnvoi eumdosonpr rsuecmurrrdu électronie tsbr> p>

LLlorghltci@gmaai.omp br> sbr> p>

LLIddie trauesobjesbsp;;:C&dosonpr depcandidaousea1513-1515 br> sbr> Pwur plusnd8217;iaielormasine,&ve rleqzéomeiuet rd#8217;anurtecle nteiacré lss16aaoût01512 rsueAlé Pcmsnpeàdc ttcfbwursdCd8217;avexctllt clbsp;: C&br> paRhref="http://www.aet rutrcir.org/ip">.php?urtecle13242"lass="spip">_out">www.aet rutrcir.org/ip">.phpbsp;:&?urtecle13242 br> sbr> p>

L />p class="spip">LLrt-au-Prince, ,aj rleqt01512 br> sbr> p>

LLLssbrong class="spip">JICnmaéddddsDireconneedu CgllègqnNaonnelr&desaIngéniursdNqt0Archittes,sdHaïtrue=strong>&/t(C.N.I.A.H.),dt#8217;iaJIAciocittn (dHaïtruende#es0Archittes,sdrt&drsRUrbanrstc=strong>&/t(ASSHAU)ledo#8217;iaJIAciocittn (dHaïtruende#es0Entreasi"eDo#ddCteitauctionstrong>&/t(AHEC)roiansm(tee cfnmpitdls # elettss0conjoi tepudrrcié,ae PtecreraMasattse, M.bsp;:&brong class="spip">JILsurr /nSalvador Lamothdstrong>&/, envettsedu 6aj rleqt01512. br> sNs levs leasn (svde bruedroulr e(&utedess0ntrntissae.caetrencmurageosaolssvmbre ,sddpc#ssaptofecin aàsylinnluruCls rdnom csesvoyantaenercmnfnrmasinenssdn# éaorme #ddcmntacte#asrsnieeqassdn#eéinteehttp://www.cniah.org/comrdteneacutees-et-cmntact.html (page dedcmntact)eoueeovoyerne cemaaiuenmcruel aàspaRhref="http://maai.bungfder.omp/edgsddck/cgi-bin/ntmpose.exe?id=016020f0dc8bd7c920ea3be88408e0bb4231&new=&xsl=ntmpose.xsl&to=ielo%40cniah.org"lass="spip">_out">http://maai.bungfder.omp/edgsddck/cgi-bin/ntmpose.exebsp;:&?id=016020f0dc8bd7c920ea3be88408e0bb4231&new=&xsl=ntmpose.xsl&to=ielo%40cniah.org ,dtoueeontreupasnpr #adligdere irtes,menéPa buruaumduabrong class="spip">JICNIAHstrong>&/teiouddaubsp;;:C br> sbrong class="spip">JI22 Ac Maglor d Ambroi"e br> sChamplodeeMsrs,urt-au-Prince, br> sTelbsp;;:C&2943-1111btrong>&/ br> sbr> Pt-au-Prince, ,l#dC6aj rleqt01512 br> sbr> M.bsp;:&brong class="spip">JILsurr /nSalvador Lamothdstrong>&/sbr> PtecreraMasattsesbr> Gvenrnlent.,adpc#aaRépee ii ec#8217;anHaïtrsbr> EncsessBuruaux br> br> p>

JIObjesbsp;;:C&APPEL DES INGÉNIEURS, ARCHITECTES, URBANISTES & ENTREPRENEURS DE CONSTRUCTION HAITIENSsth3>p class="spip">LLMtrseesdn#eéPtecreraMasattse,sbr> Le CgllègqnNaonnelr&desaIngéniursdNqt0Archittes,sdHaïtrue=t(CNIAH),al8217;ÉOAciocittn (dHaïtruende#es0Archittes,sdrt&drsRUrbanrstc=t(ASSHAU),ledo#8217;iaAciocittn (dHaïtruende#es0Entreasi"eDo#ddCteitauctiont(AHEC)rso taa#armés,deent reeslés, etsdé on sntaencéts,adpcfoiMéqii i8217;avtsppiestaieé deau s aariagédiledu 12 janvrera1510, tté&#iasrreeqaroulr psedurer. Il s8217;anxginr#laa8217;iaentruinnesériangè l iejticcfiée d saolssveiffénectc=tbrane séptofecin nlallludse#8217;aningéniurieledodse#8217;anurchittesur,ed saonotrlcu ys. Votrlctt raesrnrèrqnan on, ,lrelrifvdpàe ént ve minensigdéraleé13aj rn01512 otreelplGvenrnlent.,adpc#aaRépee ii ec#raChinda(Taïwan)eete SaGvenrnlent.,aHaïtrue, i luitrepccttcfutsitudeé&#iava=àe 8217;ÉOeontntseudps loisarég sst sél8217;avexercicd depccsvptofecin auetHaïtr.LCepaaccord, poroa.,assdnu(&mnetantadeoUSD 4,275,000.00,entrc,unpc#aéntrctptineset eDoétuessedepcinio(5) bâtime ts&pee icsbsp;;:C&Co l&deaCs="asine,&Masattèr,eddd#8217;anEet omeecrt&drsRFnrne,am,sDireconneeGénérles&desaImpôts, AdmasattsasineeGénérles&desaDouands,uCo l&Supéi r rs&desaCmpptgsPetruuICofet MiruxeAdmasattsasif. Il srreeqa’anllecustitàéédddécidésurlntrarrent.,aq epccsvétuessesestie msassuréesdpsueu(&cabinetNaméi caine#8217;ioorigi cftaïwanaqs/,p#8217;anOECC. Il srreeqaigalqmsnté&#edd8217;anx i amant éra,sc#8217;anétuess,ver r &me lsd8217;avexursifne,&sustie msé tsattribuéseàad8217;anx i amascciéédssériangè ls,u#omen cainddNe(&rurteculitr,ds saoareescàsct curae , ,lsaesentrsultasfne,&eensurot ssaeserurteciplon ( rcofecin nlalldhaïtruend. Ns lenieonsbsp;;:C&ls Palai ddddJticc.c,l#dCMasattèr,eddd#8217;anIntéi r r,l#dCMasattèr,edu Com lrce,eete SaPallumlnt. br> sbr> HaïtrCn8217;avtsppia aaeas ul&p ys& urmtrddJàureceer adse#8217;anuent ent rnaonnelrlsewuramenerndesRopésasi (svde ntrctptine,c#8217;anétuess,vetad8217;anexursifnee#8217;ioouvrsgcsapee ics.ICe dp ys&exi,unté&#edd séptofecin nlas loc uxesoie msadjrnsts& uxeptofecin nlas ériangerluenmv tdl8217;anassure u(e&harmoncssonne epaencéchangdvde ntrntissae.cs.LCeaiartenarea,,dlibrent.,acneiintrCentseuptofecin nlas,crstaneesexigt claasimir dodpctt raeét éologisseocrstaeicoéauetHaïtrCpsue#ssarègl meses corporltnltes. Cea éaentraitaàe# écrédtfnee#8217;io82339;uvresd# saolpsqllllssesestie msinntrporésd#pseéléme ts depnotrlcrichd culiur,ledodepnotrlcurchittesur,, qiiuo.,etantaftipaa ebee Mertul8217;ÉOorigi lriédddpc#ssavrleqdNàenec=époi ec#o sé,. br> sbr> Ns leasofieons depccttcfopiortuntté rwuravs leexasimeronotrlcuréoccupionneassdn#eéfoiMéqiraccsvétuesseseso.,eme éesds saol8217;ÉOxdoptn ( rcéalable d8217;Éiu(&slae dirtes, l&ou&me lsd8217;avu(&schémadl8217;anamé#agemt Mredpc#aaRégine Mérioewlctaend.IL8217;ÉOipaacteqi8217;Éie so.,eéve msrlllnt.,rccsvédifices,lsaeseraccordent.,aàcddsNiefraatauctusesPetréq ipeme ts urbaieserréalablent nspue=ésuetJlocali=ésu(drainage des e uxepluvilsesrrt&oiaiteme tades e uxeuséddNe(&rurteculitr),éserasrrobablent nsdésaataruxerwuranotrlceovirnenent n. br> sbr> VotrlcGvenrnlent.,aprôdantae rrespect deél éloi,nqi8217;ÉOi é#s lesorpluseiisadearureesern csdtermesc#es0Artecles 9rrt&19,rrespectivrnt.,,ed DécretruuI25 marss1974bsp;:&; eté#s lenieonsbsp;;:Csbr> #171;nbsp;?LJIARTICLE 9strong>&/.-aLesRÉriangerluielisvdetdiplômssernctenusprsue#8217;iaÉtttdHlïtruesnevso taauiosaséseàaexercern cur ptofecin auetHaïtrCqusrewuralssespécilsttésd# saolpsqllllsse#es caeresnptofecin nlas Haïtrue=tso tainexesoa.,luoupiesuffrsa Msvepa odsddcmelormantneuxs#asrsiionnescee&claDécretretneuxsx i amaLo s envvigus r.bsp;:»Msbr> #171;nbsp;?LJIARTICLE 19strong>&/.-aIaéns sesecndue&#ed#es Déiarteme tsCMasattéi rls,salluco lseddpjtici.c, l,séTribuelux, l,séAdmasattsasineséCmmielelss,pl,séOrnisatmssePee ics Autt omes,cetc...éne r ntentîtso.,ecom lsvalideluaaee csdslaes,pl,séétuessegénérlesmsnté&#elntee ts,saesddocumeses oudcseénficats&drariav uxededGéniu oudl8217;anArchittesur,, soumis,prsuee =oue#dsvmbre ,sddu CgllègqndesaIngéniursdNqt0Archittes,sdHaïtrue=.bsp;:»Me_afie #ddnieionnea(#es motsnsoulrgdésvepa odgrasuso tadpc#s l). br> sbr> Ns lesouhltcesn (s, Mtrseesdn#eéPtecreraMasattse,éqiravotrlcivenrnlent.,r eas nnrv dant érôld depccsvaffarres&e(&requéao.,asyttémdtiq mesee 8217;ÉOéétb ncieme t ddaiartenarea,sCentseuptofecin nlasdhaïtruescetéoabinetsrcmnfrèrqs ériangerl,aomp sualuve eqnt #ssalois. Il fa ssaer aqipc#ssaptofecin nlasdne mesus,nppia aaeuroengageme t (er r &e8217;esend(ttc., lr r#ent.,apwuracertaenl) afie #ddseam(tts àene (irsauvde ntmpéttonvaéésct curae Mirlllaomp sua8217;anexigeaisntélesademn des0dcfmanrlscoasnnesnd8217;iaietéiêtpudrrcié,sprsue#8217;iaUniédddpcCteitauctiontdpcLogqmsntéetédpcBâtime ts&Pee ics (UCLBP). L8217;ÉOintruinnesrcofecin nlalldériangè l etciejticcfiée bsi"eras 8217;ÉOélae dpc#ssacgllèg tsuetJuesamèdersabee ctup à émigrtrauester auériangè l,ssicerued 8217;avtsppfoiMéenmcruel .sbr> Perluadésdqiravo lessurrzaot sm(tts e #1339;uvrerewurarectifier #eéctulseddc cho"eDort&rérsr rd#8217;aniejticcceéfoiM àe#ssaptofecin nlas,é#s levs leasn (svd8217;anxgréer, Mtrseesdn#eéPtecreraMasattse,él8217;anassurancusdddnotrlchaué,rntrsedésasi (. br> sbr> JIPwura dCCNIAHstrong>&/bsp;;:C& br> sbr> Gésard Lucoan -Baptnlte,aIng.,éPtenent Mre- Gésald EmiseaBrun, M.bsp;:&Arch.,éVcce-Ptenent Mre- Alix Muliidor, Arch.,éTtenorrdusbr> sbr> Gid pte Bausoae Bungfder, Arch.,éSeosétir doGénérlee- Hervé B. Déjn ,aIng-Arch.,éCneiilesern- Max Mériypr,aIng.,éCneiileser br> sbr> Olibrne Cangé,aIng.,éCneiileser n- Preras AderéeLosasca,aIng.,éCneiileser - Patri,k Aewllon,aIng.,éCneiileser br> sbr> p>

LLPwura 8217;iaJIASSHAUstrong>&/bsp;;:C& br> sbr> Paul&-EmiseaSimon, Arch. DPLGF.,éPtenent Mre- Gesald EmiseaBrun, Arch-Urba.,ééVcceéPtenent Mr- Freneri,k Mangonds,uArch.,éSeosétir dsbr> Raphaël Izméry, Arch.,éTtenorrdur- Li (el Allen, Arch.,éCneiileser n sbr> sbr> Pwur 8217;iaJIAHECstrong>&/bsp;;:C& br> sbr> Serge Saint Louis,aIng.,éVcceéPtenent Mr oan -Robrté Jacinthe,aIng.,éSeosétir doGénérlee- Franck Romain Jr.,aIng, 2è suTtenorrdur sbr> sbr> Suive ms&#eli eloergdatusesPdeuptofecin nlasduesappiibsp;;:C br> sbr> Jaci eloAntoind, Ingre- Dutède Délasca,aIng.e- Gi"el éN.aBrun, Arch& br> sMsrpi cfCserrobrun, Arch.e- Msrpi dL t r Julesa- GeorgesaLescot,aArch.e Kare cfJ. Bwunheree , Arch-Urba.a- Serge Desplant,s,aIng.re- Gid pte Chérubin, Arch.e Rnelrd Laraq ,sIng.re- Robrté Pa et,aArch.e - oan e cfL.aMaleqt, Arch& br> san -B rnard Maleqt, Arch.e- Domen qiraMathon, Arch-Urba.a- Patri,k Virux, Arch.e Béatri,e LarghiéCnrbanes/,pArch.e- Philip Maglor d,aArch.e - oaho"tia Fuent,s,aIng.r MarielDa ièseaE.aDauphin, Arch.ee- Gésald Osn l,aIng.rPE o#18230;#18230;#18230;. Etnd8217;anx i ama br> br> p> <_documese_1503 ip">_documeses ip">_documeses_cesecr' <

p>dt p>dl>p hrlass="spip">L />p class="spip">LLrarnl,ale 26aj rn01512 br> sbr> sL8217;ÉOéd s uroen Franc,eddd#8217;an#1339;uvrerewétce tdluvgai e énsavain haïtruedbrong class="spip">JIAdthony Phelp=strong>&/tcmnfnrmse#8217;aninlormasineveiffuséd hier ouraceéinte,éenr oulit.,rrsueccfnmmieliq é deuptmsnpe a postonne cmurageubqadueuwè raesarefusure 8217;iahtmmngqaduePtenent Mrbrong class="spip">JIMichdlsMsrpellystrong>&/ttantaqiraleéeicolte leDuvalierd eéserasrs=rrppsilnenénrt&pelieewureeesmnore ,uxecéfoiMd. br> sbr> sbrpae ass="s'ip">_documese_1501 ip">_documeses ip">_documeses_cesecr' < sbr> Adthony Phelp=éserasrrenentoen Franc,edu015& ur28aj rleqt01512 da luaeacaereanuefelonvalcdpcSè ra(Hésauli)bsp;: C&bilass="spip">LLVoixeVivrscdeeMéd s rao.ée uedMéd s rao.éesti>. br> sbr> p> <_documese_1500 ip">_documeses ip">_documeses_cesecr' <
p>dt p>dl>p hrlass="spip">L />p class="spip">LLrt-au-Prince, ,lsamedi 23aj rn01512 br> sbr> sL8217;ÉOinlormasinevtsppreewrédsrrsubsp;;:C br> sbrong class="spip">JIdJIRadio Kiskeyabsp;: C&dHaïtr-Franc,-Pwlctce tsti>rstrong>&/ br> p>

JIL8217;ÉOambassade leftarçailarefusu #ddserrpr #admain ddoan -ClaunteDuvaliersth3>p class="spip">LLCearu l iecent Mrdiplomdtiq Centseubrong class="spip">JIDidrur Ls Bretstrong>&/ortul8217;ÉOne,iuestytar i8217;avtspprérou élsamedi, e(&utenenc,edddtémuiss,fe z cseJIfrèrqs de Saint-LouisededGonzagudstrong>&/, àe 8217;ÉOoccain eddd#8217;anun(irselir dodpc# éao dasnnesdepccttcféco dant gréganrstc=phard br> sbr> sbrong class="spip">JIan -ClaunteDuvalierstrong>&/ta&étélsamedineu centseud8217;avu(&iecent Mrdiplomdtiq Ce z csefrèrqs de #8217;iaiestauctiontchséta nnrvSaint-LouisededGonzagud oùél8217;ÉOne,iueseicolte lei8217;avtsppvuarefusure a poigdéradcfmaie qi8217;ÉOi éroultitàéchangdrsac ld#8217;ÉOambassade ledcfFranc,,sDidrur Ls Bret,aa rureor tsu(&témuiseasnviaégiddàdRadio Kiskeya br> sCeptesscède i8217;avtsppptoduiM d saol8217;ÉOenc,int, ele 8217;ÉOéétb ncieme t nt gréganrstc=loele#dflsécérémonccfnmmiémosasivraesassrs122qnan irselir doqiiocoïecentitàac ld#pseciniut /dpa(svde nie religieubqadueJIfrèrq Serge Larosdstrong>&/, ne,iues moot bllmséde #8217;iaiestituénne br> sbr> sPrenentod saol8217;ÉOxcinsoa .c,l#dCptofeci, l&d8217;iahnltor d brong class="spip">JIJos é AgénorpCadetstrong>&/&utecile qiraleéeiplomdteeftarçailade i8217;avtspppamant éenédddpcréag l#égaonvtnt.,aàcaavdemn decdeeM.bsp;:&Duvalierddeél i&serrpr #admain. Il s8217;antsppx iomdtiq meseeretrréeewureeeporvenrndenera i auplace,aloieedu viins uroenaore ant. br> sOutrera8217;iaietéiessé,mdirsel ne,iuelessint-louisiueledevtduluessersel tnalitésexcinsoait.,aàcaavcérémoncc,prsumi e xel8217;anex-Ptenent MrgénérledJIPcosperJAvrilstrong>&/. br> sbr> Il s8217;anxginr#uvdeuxiè sugestqasymbo ii ec#8217;anho"tiltté rwséa o i eli eloursrluàe 8217;ÉOeontntseudpél8217;ÉOne,iuesPtenent Mrà nie (1971-1986),rrentséneuéu ys&ee 2011 de façodJinntmpréhuelieeqaapsèsdensexilcdpc25pa(sven Franc,.IL ésemaindedernrèrq,l#dCcélèe , ewè rabrong class="spip">JIAdthony Phelp=strong>&/tavtitàm s envcca.,aa8217;ÉOipauntté ecandaleubqado taursite 8217;iahtmmerewurarej te aunesdnsoinconne qiral i&avtitàdéc,uné, céPtenent Mrbrong class="spip">JIMichdlsMsrpellystrong>&/taassirqi8217;iaàrru CiursdNx i amagai esr easenentantle#dflséltttésasurldhaïtruend cnetcmporaind br> sCirculanppiarot Jauvvolt tedecsaver sur,, accompagdépr8217;iaunesescortcfrulc.ièse,él8217;anae,iuesx ioccdtsta&étél irtes,menéPaciociéneuéuttjesadea#171;nbsp;?Lrécneci iasnnesnaonnelrlbsp;:»Medu&chef dee 8217;iaÉtttdmalgré lsmagaivrsceccusasi (svde nrnmesPcofease#8217;iahumanrté,acor uptionretsdétt rneme t de f us&pee ics pwrédssPcofease#ur. br> sbr> Deau s 8217;ÉOordtent clact éscoé aefdd Cen janvreradprnir1&ssue s uuglpiestauct urobrong class="spip">JICarvèsdan strong>&/tee fivr ledcfan -ClaunteDuvalier,cla=urmcédurldjudiciar d0engagédCtsppprdtiq meseebloqué,aetcil srreeqadedmuissauedmoieserrobablesqilsl8217;ÉOtx-mtîtsqadedrt-au-Prince, lsorpluugtsu(&jwur pwuralsseinnore tlmsslnrnmesPdecsa clesassrseegnme.r spp/brong class="spip">JIdJIRadio Kiskeyasti>rstrong>&/ br> sbr> p>

L />p class="spip">LLrarnl,amai01512 br> sbr> sNs leavosaolsàrllis adseflirqnpasnpr clt urtecle qilsl8217;ÉOamnvbrong class="spip">JILaëendc Hurbonstrong>&/ta&pee idddébutrmiterwura dCbrong class="spip">JIdJIBuleqtie #ddl8217;ÉOObnprvator d dep# érteteitauctiontuetHaïtrsti>rstrong>&/. N8217;iooue ioeserusauedeffetaqirasip# érteteitauctiontnqnpasnppia aa xeyeux&esabee ctup decdécids rn,ahaïtruescomp suériangerl,apsue a culiur,, c lle-ciudrmr rs&ne&p trinoinda#8217;anund richdcirdrxriaordinarrelpwur 8217;iannnrreeqadueusuplsa#8217;anHaïtr,enec=usuMdesse Mirllladue&#otidrueado tail srraien iffic lu #ddsenpasnpr. br> p>

JILa culiur,=oue dCpilierdabst.,adpc#aarteteitauctionsth3>p class="spip">LLbrong class="spip">JILaëendc Hurbonstrong>&/p>

LLDeau s ru CiursdNmois,saesddébatc ewlctce tsureatt.,afocali=ésussdn#eéuruvoi1pexursifféenr aaégionmtté - (LcéPtenent Mra-p-lleoiiuourno(&unesdouble&naonnelriédbsp;:&?)-,toueeontreussdn#esént éra,scntrc,una msl érteteitauction- (cesént éra,screlève m-llseoiiuourno(&d séptatce tsude ntr uptionbsp;:&?).aDa luts le csdcai,p# érteteitauctiontomp sutrl#dCn8217;avtsppia aeontreuauaefddez-vs led séptéoccupionnele#dflsécss="e&sulctce tl irigea Me.rOntnqnpouralado cde8217;ÉOins rao,ulessdn# éplacee#dflséculiur,=da luaavrteteitauctionte tdnura a basda#8217;anund ficénne sMsis clt exercicd n8217;avtsppia ainuéile, i re séve msrlllnt.,-psàeoùél érteteitauctiontu paàu 8217;ÉOééttPdeuptojes-&offr aqipli eloprstc=tdpcréflexionretsd8217;ÉOacénne br> sbr> sL8217;anund essdcaracéésistii el pnce,ip lelodu&chaom éétb n da luaavcapitalqcdèle csdptecrersNiestantle#ud éismlea&étél eam(tts lssesurviva.,Dod saound ptoxnmtté inattfdd Cetciehabimsrlllàac ld#psecadav dc ewsdn#esqiplluo.tnqnpouvtitàguèr,edasrsierddeémonsesPdeuptocéderaàcund sépuliur,=dcfmanrèr,edagn,.pCrptesmodlriédddpcrureor Centseuviva.,Doetrmotéaodteneélteu àene éraumaeieeividuqeeetéomlltesif.IUnutraumaeé&#iasrrand8217;anx ianppilusdrrmf uPetruustlmsasipl#dCptoceciupt#e érteteitauctiontnqncréuprsaolssvntneisinese#8217;anund iémorre- ouve #dflsécataataophr.aDa luaeagestqadp #adlépuliur,=8217;1;uourru dNexaes,menéPd sao arimsalttasnne-de8217;ÉOinscsituaavcapactté dseflirqnlu #duildd séptoe séqiiuo.,edasraru.IL écémorre- ouve a&utecilént.,apwuraviiéradcffivorisure 8217;iaoue iortul8217;ÉOnpaqs/me tades anxiééds. Tqee#evaltcaêeaselruel aduéuttjesadeaiémosaaen#ud éismledo taa8217;iaieaugurlonnevdu 12 janvrera1512,vdeux saoarsès,pltisseaeontreuot Jobnprvatr leda luaavru dNgai ecfpseplexité. Pwurra-p-on voi1ppsueexemplsa#a lubrong class="spip">JITiti nsestrong>&/,o#8217;anesraclachoisi&ssue s ur er arwura dCiémosaae,eneélteu urerossié,mdigd drt&upM àentneuirqnrselelu #duildrtul8217;ÉOoue iorérsrlor lbsp;:&?rOnttsppx iosaséeàaene t rr,ccar clt esracla#8217;avupjamaisrergdcfiéejtiqi8217;Éiic qilsla banalttasnnesdsslnrnmesPdecl édicoltur,=dcftnectc a luessebrong class="spip">JIDuvalierstrong>&/t&#iasavtie tayaabandnenern cursavrctnmesP-llsdopposl ts réplluoursupposés-com lsdrs bêtgsPetr csdptiverddeélépuliur,.IL éutenenc,e lle-me lsduseicolte leàaa8217;iaieaugurlonnevoffic rllladueiémosaaen#8217;avuura-p-rlllarsaorwuraeffetadpcruviverdetsd8217;ÉOaprrmf uidn#esélmss"usesPdesavrctnmesP#dflsécataataophr&sulctce tle tl easenentaitacettcfeicoltur,bsp;:&? br> sbr> D8217;anund cataataophr&àaa8217;iax i a,p# éi elonneP#dflsécémorreudrmr rs&# écroixeduéuttjesadearteteitauctiont#dflsécapitalq. Tt raculiur,les sesaeffetaf uéeassdnu(&mnddaiarteculitrddpcrureor Centseulesavrva.,Doetr#es morts, otreelplviinlmséenra8217;iaieviinlms.éPtoductiontom Minu lle deuel ,eélévasnnesdepsornrseleenercmnrtonneeplusnhumaasa,p# éculiur,lne re tpjamaisreeadéployernd saol8217;ÉOieattfdtn eeux trac ledueu ssé. AassirpsueexemplsalesmnorsP#dfliruxeomp sua ecroixedesmBo="algsPetrFor Cdimanchc,o#8217;anu(&eesvoyantaàn# éplacee#u marchée#u boisrd8217;iaébène,él8217;anautreraud ystème #dddégaidasnnesdep#8217;iahumanrtédd séptilnenisele#dflsédicoltur,=duvaliésist,, so tades sitc=tdpccémorreuàu 8217;ÉOéglr&desaruinddNdpsehabimionnelesucrrèrqsacglonilsesreioude aa xeaeqnto lseddprt-au-Prince, ,l=oue#dsvnore ,uxefotéaoeppialai dqiiocoestituentaenerusuMdimporoa.,qadueu trinoindabâtiedueu ys. S saonule t r,e csdptecrersNia adral érteteitauctiontseso.,e eaérés&cca.,aot Jda luaavquêtgeete Sarespect desdlieux&esacémorre,ac scmarque lseddpl8217;ÉOint Mité dea#ancapitalqce,adpc#aanaonne sMsis attfdtn bsp;:&! C8217;avtspprwuranlarsaoêtreae assveedueu sséoeppiwureeone#éiacieme t qi8217;ÉOi éconvre tad8217;iace,ite aauaefspect desdtrac ledueu ssé.sL8217;anopiortuntté offsetrussue s éismledu 12 janvrera1510n-àariavselelaadeitauctiont#upialai dnaonnelr,sdrs bâtime ts&masattéi rls,sdesRunirselttésdrt&drsRéco ds,sde muséddNe,adpcbie iothèi el-rntrsest,=da luaavposonbilt Mede ntr i,uleoue#dfcréurscr q pda&étéljtiqi8217;Éiic négligé da luaeadomaindedeé a culiur,, c8217;avtsp-à-diss0de&ptoeuirqnlssveisrsiionfs (NiefraatauctusesPetriestituénned)Jinntnto lntlmsslrwura écrédtfvaéésculiur,lllaomp suPalai ddds nt grès,pthéât ,,Ccofnprvator d, muséd,Runirselttés,lsalms du8217;iaexpostonne, esraclslrwuradds felonvals.p>

LLAc#aafie #dsnxenéss 1960, txnsoait.,arsaomoiesedss16asalms duepcinémadàprt-au-Prince, ,ltandiséqi8217;Éia ursrd8217;anhuipia aureas ulla#8217;avupsurvécu -rno(&ia aa éismle-éctis& uxepéi péttesP#dflséeg>&ud een iffic lu #émoccdtisationt#dflséscciéédedss1986 àe#ssaursrl. C8217;avtsppdi au&#eoaavnoratégitdls # erteteitauctiont#dvalffivorisuredoréncca.,aot Jcr q pdde&ptèseoue#dfloieentrc,unpccqa’anonoareeslu o#171;nbsp;?Llcfnmmielbsp;:»M,dcr q pdfotéifieeouerelrnc,eldflireseocils, c8217;avtsp-à-diss0cr q pduseie,adpcsotéi #dflsécmnrtonneedpél8217;ÉOnusuMheidsculiur,léenr ocils q pda&étélc lle deflséscciéédehaïtruend eivisée uednec=élt e (Npolctce tdetsietrl#dcmsrlll)dde&pu dNe(&rlusn réduiM àenec=usauvde nhagncerrt&drsRmasssselivréesdàe a polctce tdobncurantesoraesseru er s.IL écsotéieedpél8217;ÉOnusuMheidsculiur,léenr ocils,utrl tspps8217;iannjr cvésaéabltdls # erteteitauctiont#da#ancapitalqcPetruuIu ys,aetruo cdl8217;ÉOeffor Càacneiintr arwuraflirqnssdaitss0nec=nasnnesdémoccdtiq eet c lanpasnppiarr#es monsesPq pdassus,npplruel time tad8217;iaupiartenan, àenec=me lsterrp,eneéme lsu ys,ae ,f q pdumusssaàchabite allcu yséeté#s(&rlusnà rêverdeteitammesee 8217;ÉOaaies rn,acettcfeoluénne eumdismootr arwlctce tdvis- à-dvisa#8217;anHaïtr.IS8217;ÉOi éenttsppxassi, i upiartie msauxeHaïtrue=teux-me lsu(d8217;Éiic ,ce,adpc#aadiaspora), àeriavselele lsediffénectc=tatauctusesP ocioptofecin nlalll,dde&ptedess0uedmain ddomanrèr,eeutt omee csdpttjespt#e é# erteteitauction.p>

LLCqa’anonoeteitatearwura dCio snt,ao8217;avtsppeontreu-aomp succa.,aae éismle-é 8217;ÉOoccupionneau8217;iaesraclslree ics (Champ ddomars,ursimituse)eoueptivésu(MounpcHerculsaàcPésnne-vrleq,prwuranla,ite aqirac i-là) da luaearu dNgai esdenoress0rsdet / plusndevdeux saoetnd saol8217;ÉOiedifféneccppiarrrureor C uxeptoblè ssaeovirnenent n ux. Ve usssdrs bidonvrlms deovirnena msl écapitalq,sdesRaelaiessCentrèrqsasevso tautecipitéesdvseleclslesracls,futsiréesdpsuellsdxidelupiallisonvrs offsetrsdpsuellsdONG (ee , soiesemédiclux, kitslaltmlntarres) eppiaro#8217;anesrr adsereceer agaicieubqmsntaenclogqmsntéoue#dfsotéi #8217;avu(&système #ddlocasnne upiauvlttst t.pCana ,assdnu(eéomllinesdenseéne tdls # ert raeu Nord, o8217;avtsppl8217;ÉOinnarnasnnesdepccttcfuttpitdq pda&ot é le saxreare clscd8217;anund chimèse,étantJ#rsRntneisinese#e nie cmnfnnt Mrà clallludss bidonvrlms . Tt dsenpasnpuinrnllnt.,rcmp susiJ#rsResraclslree ics dea#anvillqce,adpcss deovirnesuso tadpvtdulu#rsRextuelionludss bidonvrlms ,éenr o.,e estésd àoccupésdpsuellsdmarchésRielormlas,crnfsotéqa’anonoreorvenràac ldpeineélesaéraclscdreculiur,l’6;absaéeseer tsuetJmtis (l,amêmee csdmonume ts depl8217;ÉOiedérsdet ctdnrreeqnt psedruCls rdergdcficasnne.p>

LLEntretempl, da luaeavacuum dep# érteteitauctiontut&drsRiestituénnededee 8217;iaÉttt, ru CiursdNcompagdtesPaméi cainlsdxissirqilsdlsdONG essopose tades mtis (lautefabriq éesdsusctptilms du8217;iaêe léipalanéddsvn8217;ÉOipaotéqaoùdrt&uc ldruridaééslsaese&#eoaavi elonnePculiur,lllaneélesaeffls re.IS ulsacertaenl templssdpttéscoases iserem(ttc., debt Jauviniieuedpél8217;ÉOnusthis0cdm sattsasivqce,adpc#aapaende#e rêveadueuwuvoi1bsp;:&; llsepsuvnne.antéàtsesvi #dflieuedpéeteiolssnnesbrueduteclirqneu c#1339;u #dflsébanalttasnnesdsu 8217;ÉOévèneme t d éisml.IL éculiur,=devaltcadnenern c&otndàe a rteteitauctiontiwureeotéi #dflsérwlctce tdriaeisinenlalld#omenée&ssue 8217;ÉOiparovcssonne epalsécmr uption,éctis&ot Jct cmurtéàtmofeasdn&#eoaavculiur,les srwura dCio snt&ne&pilierdabst.,adpc#aarteteitauction. sbr> sbr> p>

L />p class="spip">LLrt-au-Prince, ,aavril01512 br> sbr> p>

JILE DESARMEMENT D8217;ÉOHAITIsth3>p class="spip">LLNotrlcumnvbrong class="spip">JILaëendc Hurbonstrong>&/t#s lenmmieliq e clt urtecle qiia#8217;avupmalhe leubqmsntaia avaltmqnt psedue#dfsoncaesulriéd.IL éutemrèr,eiartiecrstaneesréflexionrdueriaeues, l&ded#8217;anurtecle pee iddae amedi 21 janvrera1512 da luaeajo lntedJIdJIEl Nueer Diasti>rstrong>&/, àeSan Juae dpcrt-ao Rico,ussue s Ptenent Mrbrong class="spip">JIOscar Ariasstrong>&/, ptix Nobrl adpc#aapaix lt ex-utenent Mrdu Cgcoa Rica. C8217;avtsppJIPreras-AderéeTcéva MrDenrnt Desroonprsstrong>&/t&#iaaeriaeuinr#lau s 8217;ÉOesragnol. sbr> sbr> p>

LLNOTE DU TRADUCTEUR. L énvenrlle deflséeréiestaieasnnesdsu 8217;ÉOarméldhaïtruend futaneesgai ecfssdasi"elrwura écmmieleuté int rnaonnelrl. L éeéacsnnesdsu 8217;ÉOex-utenent Mrdu Cgcoa Rica,pbrong class="spip">JIOscar Ariasstrong>&/, ptix Nobrl dpc#aapaix, futaimmédiace. Il méi tepnotrlculusdrrmf uesgaisitude,ccar ilddémofeaspeontreuund foisrsoncamwur pwuralssbrue-êtss0de¬rlcu ys.sbr> sbr> p>

LLSesdssgcsacneiileDort&r ntmmn dasnnelareflètc., clarrent.,a 8217;ÉOexptmsninensincèr,edddsoncâ sua tino-améi cainlé&#iasruel tfeolenti d dep# écluss0de¬rlcu ys. Ns leexht-ao luts é le salorcesavrv ledueu ysdàe saxretecierdetsexamaser.sbr> sLssbrong class="spip">JIPtenent MrMsrpellystrong>&/tn8217;avtsppiaraîp-lleia abruedcneiilelé. Ns le 8217;ÉOexht-ao luausoiJàureliase#8217;iahnltor d naonnelrlset c lle de dp ys&a tino-améi cainsneu couele#lscdrrnrèrqsàdéc,eniss. Ns leos (lamêmee ui&r ntmmn dure 8217;iaouvrsgc intitulé,dJIFABRICANTES DE MISERIAsti>, énsappiarobrong class="spip">JIPlinio Apulsyo Msdeoza,pCarlos Albrtéo Mtroaserdets Alvaro Varga aLIosastrong>&/, édaéésliaroPlazadetsJadésven 1998. L8217;ÉOarméldhaïtruend ne re t,crnfaucund omanrèr,,éaentrJàurécupérpr #addigdaéésnaonnelrl,ccar #lau s s écrédtfneecop seaorcee#dfgsdetrmlrielen 1916,arl#dtadot ursrlué tsu(&ornisatmsorértmsnifretneuiosatar d,aaué, l&dedctup du8217;iaÉttt, und vra csa csusrewurals budgeté#aonnelr,snec=marinenlttcfuutsesvice&drsRietéiêts dea#anMtis ( Blanchc,odueVaoncance,adpcss darossssvmbre ,s. Récupérpr #addigdaéésnaonnelrl,cc8217;antsppxsssinidn#eséfnrne,amupee ii el, éiaeie tralsécmr uption,éfotéifieue s ystème #8217;iaiestauctiontpee ii e,PaméliorerJ#rsRntneisinese#e st té,acréursd séptogaimms du8217;iaxcinsoa .c r ocils ,lreleveue s tandard #e nie dds ntmieleuté dp uvresdp ysaends,ucréursd séemploisrrwuraflirqndasrartîtsqalsécsdèrq,odénrloppure 8217;iaagncculiur,, réornisattralséPwlccqnNaonnelrsrewuraassure déc,mmesee #adlécuraéésldesavresdrt&drsRbruescet, enveprnir1&lieu, ptomr er aeneradmasattsasineepee ii ecsainléetéptogaessest,=ewura garanteralssbrue-êtss0omlltesif.IAassirHaïtrCcecirrandlstedess0sadmain ddonasnnesmesdia.,qassdne csdprstc=tint rnaonnelrld. br> sbr> sIUne fo s entreasi"eD,ac sciettisonvrs&ptoeuiro tades tenultassdrt&drsRcca.,sgcsapalptlmsslqiiocoeeuiro taHaïtrCrselelu chcmint#da#angai ecur,cla=nolmss"e,él8217;anhnenlureete Sarespect, ynonym leduentrctptndevdigdaéésda luaaqllllse csdHaïtruesceté csdHaïtrueneseseso.,eoiaités,é#seecop seu(& monse,éctis&und fincrnfsoi,éselsee#addéfiettionrdue philosophr&Emmn uqee KanéPd sao nevouvrsgc JIFo ecnt nr#la#anMétaphysiqilsdlsdM#1339;u ssti>. br> Réfléchissez,éPtenent MrMsrpelly. Qiraleégai esArchittes,sdsu 8217;ÉOUnirselceté csdGéniusdpttéses, ls dea#anNationtut&drc#aaRaceevs lei lumnnt Mbsp;:&! A bontuetedecur,cnSaluMbsp;:&! sbr> p>

L />p class="spip">LLAdt#8217;iaan on, rdue pttjesaducivenrnlent.,r#8217;anHaïtrndevdottrJàunvenrau allcu yséd8217;anund armél, jd omc r u s udrrcié neuéutenent Mrbrong class="spip">JIMichdlsMsrpellystrong>&/tewural pddemn duredearteteiedéseracettcfeecilion. Jd ne rrétedesNia amn e tradSarespect envselelaa ouveraind Mede nettcfnaonne-s#1339;u bsp;:&; jesden r &e ullnt.,r#nenernuedcneiilen&#eojeevsis énsappssdn#esém lseddpl8217;ÉOhnltor d. EncAméi &#eoaatasa,p# émajorrtédd séarmélsuo.,eé tsessCennecres eumdinrloppunt.,,edpc#aapaix lt lséltbrtéé. D saound gai ecfpartiecdurmtrddJeensurot sencAméi &#eoLatasa,p# salorcesaarmélsuo.,eé tseaa our, rdue ouve omlltesifuaearu dNho"til,.pCr futalséboptesmilatar d q pduiétasanlssveroitslhumaassddpc#ssafrèrqs.pCr futalsévoixeduégénérledq pdung>onçanlssvoressscdrecapturee csdsl lenripllucofease#eséétueia.,Doetr#es srtsdtqs.pCr futalsémain due oldaocq pdtera da luaeadosadueusuplsainnocent.aDa luaesvmbaies rn évéd meses ddpl8217;ÉOHnltor d,r#es srmélsua tino-améi cainlsuo.,e easenenté&unesdérsdeeporèseélevéeé#seee ullnt.,rewura #ssaéet omeeséctis& ussi, euéuis& eser,snec= our, ruseianectc #8217;iaiestabiltté rwuue#ssadémoccdtild. br> sbr> sLcéPttjesaPulctce tl e DéfsdeepesaSécuraéésNaonnelrsréétb nt&drsRobjeconfs eiffus,utrlse&#eoaavrrétedeipc#éceciiédddpcrécupérpr #addigdaééslt lsé ouveraind Mehaïtruend ec ld#a réiestaieasnnesdsu 8217;ÉOarmél. HaïtrCn8217;avasrs=rbesoine#8217;iound armél. S dlécuraéésint rne re tpêts àelsécharge #8217;avu(&ntrpsPdeupwlccqnptofecin nlaPq pdassus,ras 8217;ÉOexursifneeeffecsivraesalséLoi. S dlécuraéésnaonnelrlsnd gagdersarruesac ldunaxrearelenmilatar d q pd eéserasjamaisrulusdru sst séqirac iadpcss dvsisi .sbr> Haïtr,eGuatemnladetsNicaraguaàoccupsntélesarivisndrrnrèrqsàplaces ddpl8217;ÉOAméi &#eoLatasand saol8217;ÉOiedice #dddénrloppunt.,lhumaaseélaboréeesue s utogaimmsl e Dénrloppunt.,ldrsRNasnnelaUniss. Pe t-êtss0n8217;avtsp-clarsaorsuehasard qiraccsvrivisnu ysépartage tad8217;iau i amant joncousesbsp;: C&llseo.,,eoupilseo., eu, d séarmélsuru sst sesdrt&u(&ieveloncieme t ocils réduiM da luaeadomaindedeé 8217;ÉOéducsonne epalsést té.aLesR95nmillinese#e dmllarssduéuttjesadearétrmlnt.,ldrvstie msêe léieveloncnd saol8217;ÉOéducsonne epalsést té,e Sarenlorcent.,ldrsRiestituénnededémoccdtiq sruuIu ys,aafie #ddrécupérpr #adcmnfnanc,eddsdHaïtruescetéc lle deflsécoopésasi ( ent rnaonnelrlsdo taa8217;iauent tsppiedasre bllmséepplruelrasrsdet / nec=ulusdeg>&ud péi od,=dcftempl. br> sbr> Com l Haïtr,eCgcoa Ricacrstanesrstappiays. Sseeclimitvrivpicala 8217;ÉOexposeC uxemurag saoetnu i amadésaatar dnaour,ls.pCrrsdet /,rmtrnu yséoccups lsé oixt se-nluviè suplaceemtrdialand saol8217;ÉOiedice #dddénrloppunt.,lhumaas.IUnuenlt séqipd titàa ursrd8217;anhuipàeCgcoa Ricaca 8217;ÉOesréranc,edddviv ,0 oixt se-dix-nluf sa.aHaïtrCoccups lsécent-quarante-ci e iè suplace, 8217;ÉOesréranc,edddvidedeé 8217;ÉOenlt séhaïtruedtsppde 17,4 saoulusdréduiM qirac ldedeé 8217;ÉOenlt sécgcoaric re br> sLa difféneccppexesoa., otreelsérwpueasnnesd8217;avu(&u yséetéc lle d8217;Éiu(&autrereeporvenrnd saol8217;ÉOéducsonne,r#es senéesddd somlarrté,a 8217;iannnrrgd meseém lonforml,eete Saplsincaecès& uxeésehnologiss depl8217;ÉOielormasinevtta écmmielicasnne. br> sbr> A nec==époi ec#o sé,,flsédicoltur,=rég titàdurnord uutsudnd saormtrnu ys. Aenec=époi ec#o sé,,e Sasifflsnt nr#la#anmntrarlle tenon titàot sptèsedpc#ssafrontrèrqs. Auflieuedpéptedess0#es srmeD,abrong class="spip">JICncoa Ricastrong>&/te8217;avtsppeogagé=da luaavluMM lrwura épaix lncAméi &#eoC otrlrl. Ns len8217;avavoeserusauurbesoine#su 8217;ÉOarmél. Aufnt érar d,r#epfoiMéu8217;iaêe léuémelatasasée#s lealuseiisaéu8217;iaêe lérnctenuspomp suals& esré adeuts é le sapartieleduentrflat. br> En 1994,aapsèsdensent neeadéba Centseulesadiffénectc=tlorcesaewlctce tsupanaméueneseda luaeqllle#s lerurtecipnnedeactivrnt.,,e ébrong class="spip">JIFo dasnnesAriaslrwura éPaixstrong>&/ortumoi-me l,r#epCt grèsealabo ip# salorcesaarmélsuàeriavseleneesréforme coestitusinenlall.aDlau s ors,eCgcoa Ricacré Panamaépartage ta#aafrontrèrquaavru dNpactfce tdluvmtrdd. Etncd n8217;avtsppia arsuehasard #s(&rlusnqi8217;ÉOi sr easenentsntélesadeux éet omeesé csdsl lepcospèrqs de #8217;iaisthme centse-améi cain,ussuce qilsl8217;ÉOar,unté&#iréétnt&drstasé àe#ssaarmélsutsppxffecséémaintenanpaàu 8217;ÉOéducsonne dpc#ssaenlt sséetéàalsést té dpc#ssacnecitonses. br> sbr> En 1995,aHaïtrCdécida #dddémobiltttras salorcesaarmélsurtumnt&fie àene chaeese,eé rnel&dedctup du8217;iaÉttt.pCr futanec==eecilionaxrelaunie eesue s mtrddJCentrer.sbr> Mesdlieedeac ldHaïtrCdatc., dedvingt saoà re sptès.aDlau s ors,ejlsnd cecirndevdemn dure urmtrddJdénrloppé dpc#ppia aabandnenernHaïtr,edserem(ttss0sadd(ttcRexturne,edpc# pdtedess0#sémain,edpc# pdureor ednu(eéomopésasi ( abodet /séeppopiortun,ledodepnppia aop ednewura l8217;ÉOiedifféneccp sMsis,aHaïtrCauausoiJss darossssv moot bllilttésdrt’anu(e d8217;Éilalllutsppol8217;ÉOxdoptn ( dcfeecilionsaewlctce tsucmr tes,s. Tqnt r dcf réiestaieure 8217;iaarméldsrraienun,ler tur. Pwuracela,ejlsnd pruxera agardedne casileccp ssbr> sbrong class="spip">JIOscar Ariasstrong>&/sbr> sbr> p>

L />p class="spip">LLrt-au-Prince, ,afévrrera1512 br> sbr> sLaéuémesninend Dr. GarypCt rlle teasenentsene gai eschocrewurals u ys. Oodsdddemn duraienssssqirac qilsl8217;ÉOartecle teasoduiM ic vre taureor ed sMsis,alncysréfléchissanpabrue, or i8217;avaeerçoit qi8217;ÉOi éyca àcdde&#oiucréursund atmosphèr,eiarticuliè d q p,dde&ptèseoue#dfloie,civenrnlearl#dtausoi.sbr> sbr> p>

JIHAÏTIbsp;: C&La&naonnelriédsduéutenent MrMsrpelly - ecandaleeoueécrae dpcfumélbsp;:&?sth3>p class="spip">LLiarobrong class="spip">JIPatri,k Eliestrong>&/sbr> Mtrdialcssonne.ca,pLe 24 janvrera1512 br> sbr> sbrong class="spip">JIDea#anNationlriédstrong>&/sbr> sbr> sLaéi elonneP#dflsénaonnelriédsfoiMéueunvenrauflséund ese#ssaursreluxoetnu i amamédias.ILe énat urobrong class="spip">JIMoïscfan -Challu=strong>&/tasesaeffetalâchéeund vésaéabltdbombeassdnu(eéscède sulctce tl éjànpasnablent nsxginélbsp;:&:¬rlcPtenent Mrsrraienun Itaio-Améi caineet ru CiursdN#dsvmbre ,sdJIdsu 8217;ÉOexsti>-ivenrnlent.,rbrong class="spip">JICn rllestrong>&/tdéta ndstie msplusnd8217;anu(e naonnelriéd. C8217;avtsppaearu dNré sntaecandaleeeotéiodu&chausauvde #ssapulctccruescetédirtes, lsnd8217;anvpiniontiwur,ésemaindeapsèsdsemaind,é#s lehypnottttraetsdétt rneranotrlcattfdtn ed séptoblè ssarépllude neIu ys,a&#iaso.,rewuroa.,asidrrmf uséeté#sre ,ux br> sC8217;avtsppéétb nbsp;;:C&l8217;anHaïtruedtsppnaonnelris/séepporgubaies x. Qiinpouralippaea ui&r ptoe r,aompp e-tfdusduéutix lxtre lsu yéCpsue#ssaancêt dc ewsdnriansformer #eécamp ddocon sntsasi ( areesé Saint Domengue uednec=u tri,. br> sbr> Jeam(&r vesdie tlHaïtrue, maisrj8217;avabhmr t le&naonnelrismledo tasd gargasasc., cruxe&#iaenaore c., eppiwllu,npplrudiscouelemédiacie t. Ns leveso luts épjtice d8217;Éilesacr aeneexemplsaàe 8217;ÉOoccain eddd#8217;anieaugurlonnevdu campulude Limonadd. Je&utecile 821720;campul821721;éeté#s(&821720;unirseltté821721;. EncfoiM,r#eptermeNexaes #evaltcaêease821720;complsxléipmobilter821721;éde Limonadd. Msis re sipaotéqbsp;:&! Crrsdet /,rpallur dcf821720; 8217;ÉOUnirselité dea#anHt és821721;éoue#dfla gif#dtas éné àe#strlcu ysapsue a Répee ii ecDomen caind,crelèveedpc#aapl lenrasnpubêtttt.IUnucadduuts8217;avacctptd ec ldélégancséeppgaisitude,cau s s8217;anutilttt ec ldefficactté. Encaucundcai,pi é#eessurltcasesvi #dfJIcaiu=rbeesrsti>rentseudruxersuplssedo tats épa8217;iaietéiêtdtsppde ventrJptogaessevtnt.,alursdNcofet Miruxee,adpcslis a 8217;ÉOoccain eddddénrloppure s rdeolentrtté. Il fa sremarque aqirac &naonnelrismletsppx soiJséltesifuqi8217;ÉOexaeerbébsp;:&; llade i8217;avtxerceaqiracofease#esé821720;rstapsnu ys821721;é csdsl lepcoe séueunves. Nsluténorspnaonnelris/ssr o.,e emarquablent nssileccieux&esvantJ#rsRnadduuxeddd#8217;anEsragne,edpc#aaFranc,ert&drsRÉttts-Unis,utivisnu yséqipd s leo.,rewuroa.,aclusépaearu dNdeutsrts. 821720;Dantiwurifgsd fòlesouébanannumn821721;. Affti d depvcsssds sao t r. br> sbr> En o i a,pjeam(&el aorèsemal&àaa8217;iaxttt fa, àenec=naonnelriédsbaséeussdn#ecsa c. Scruettfce t snt,ao lan cftit.,arsao# ert r. Il n8217;avyca ia adraraclschumaasas,ls ullnt.,runesespèc,edddbipèd séassezuérianges,uts leigalqmsnté t éc ewsdn#eo# ngagevtta écmenerie.rOntsabee ctup irsestéussdn#eurJptopuelionéàts8217;iaxffronttrass led séptétextusmdirsel,éàtse&oiaiter mumsrlllnt.,rd8217;iaunimlux, vor d depdémofs. L éeéariédstsppqi8217;ÉOi srn8217;avo.,ecrcié d8217;iaieter-cwpue r,aec ldot ursrlulc=me lstenultasbsp;:&:&nienec=nvenrlle espèc,,&nieneém let, nieneém lât ,,Cnieneém oa.,actis&ot Jsipalqmsntaenchumaas, ec ld#a me lsiparecin nt /sécapactté rwura écmmielicasinevtta écmenerie. br> sbr> Jeahurle uedsileccp,fe aqll fo s &#eoj8217;ÉiletedesNirsulterobrong class="spip">JITmussaint Lounrnturdstrong>&/, uedl8217;iaxffee a Mrdu titss0de&821720;Géniu drc#aaRace821721;,eouJIdDe="alasasstrong>&/tde&821720;Défsdeeu #dflséRace821721;. L8217;ÉOueecop sel8217;anautreréoait.,aessegénresdrt&défsdeeu seddpl8217;ÉOhumanrté,apoi tdboull.aRéeuirqncesadeux gét sséàaunesdnmuelionéqi8217;ÉOi sro.,eco éscoé aauéutix duCls rdvcc,p lsu rtîtdrxriaordinarremsntairrévénecci,ux br> sbr> JILa&naonnelriédsf uéeassdn#ecsa c. Qllllsebêttttbsp;:&!strong>&/sbr> sbr> Drac &naonnelrismlelà, or g nciesipaerceptilmsmsntarselelu naonnelr- ocilsisml,r#epfoscisml,r#epaicismletépa8217;iaietoléranc,.IJ8217;anattedesNec ldangoisnpe a tenurgt cladu termebsp;:&:&821720;Haïtrueda t ncie t821721;.sbr> Un ddom séamisrsouffrerd8217;iaunémis0cpss=ie t. Ile ttcaêeaseriansfusépauéCanada,fe aqll 15aursrl. Vs leimxginezubruedqi8217;ÉOi é#8217;avtsppia aorèseregarda.,asura énaonnelriédsdpcss ddnenlurs. Msis &#iaesp-llea ursrd8217;anhuibsp;:&?rDlau s cftemplrqilsdurddsoncértmenrni é#8217;avaapl leund gouMM de neIsa cletecieux transmisprsuee domèr,=oueu(&uèrq,oeux-me lsuHaïtruescd8217;anvrigi letép821720;#8217;avayantajamaisrreso cédàe uue#aonnelriédb21721;. Esp-llecoeeamsé àe#earu dNsesvi llcu yséoùni étsppnéoetnu qlllei é#8217;avaapasecrcié deevs trasanvilbsp;:&?IUnué rnel&tt ris/séàe a pduutbng>zé,bsp;:&? br> sbr> Fa t-llerureesernàe#ssanaonnelris/ssrdpcsssvice,éqiraia auraessehéroseddpl8217;ÉOIedérsdet ctd#8217;avéétnt&821720;Haïtruedd8217;anvrigi lb21721;bsp;:&; nnvbrong class="spip">JIMakandalstrong>&/, nnvbrong class="spip">JIPésnnestrong>&/, brong class="spip">JITmussaintstrong>&/toueJIDe="alasasstrong>&/. Qlantneuxssee i lsuva-nus-piedi,pi sréoait.,auedmajorrtédd séAfi cainsnpuuejus,udésvhorspSaint-Domengue. Crsehéroseqipc#sussnd ceci (svde nélébrpr o.,eforgéoeux-me lsunec=u tri,,aauéutix 821720;due a clesalsésulureetedesdlsrmeD821721;,eru tôséqirad8217;ÉOacctptdra énaonnelriédsdo ta#aaFranc,essoposoiMéueuals& ffee ed sE,asidj8217;avaiabruedcnppsila#aaCoestitusinepde 1805,arl#dtirsestaappssdn#e=u triottt supl tôséqirasura énaonnelriéd. Trèsetôséapsèsdla=urmclamsonne dpcl8217;ÉOIedérsdet ct,eddsdHaïtruescso.,resrtsdtse&batts etarselure s rdea clewura ibérerJ#rsRu yséde¬rlcAméi &#e,a&#iaaeuroenagardenppeontreur ntentissance. br> sbr> D8217;avaiies rn,a#8217;iahnltor d mtrdialan s leoffrerbruedd séexemplssddqncesahtmmesdrt&femmesd&#iasrueo.,rbattus,uo tasacrcfiéevglontarrent.,a s rdvcclrwuradds u yséoùni sd#8217;avéétnt.,arsaodés.sbr> Fa t-llerureesernleéglorrdux épisod,=dcs BrigadesaInt rnaonnelrld,éqiiuo.,emobilttédd sémillisele#dfvglontarreséde&nore ,uxeu ys,arwura édéfsdee #dflséRépee ii ecEsragnolracofease#eséfoscistusmdirigésdpsueFrancodrt&uppuyésdpsueHitlereeteMussolinibsp;:&? br> sbr> Ld gaoups brong class="spip">JIManwunhiaestrong>&/, tenesoa., àe 8217;ÉOoccupionneanaziu drc#aaFranc,ea&étélipmoroalttédssue s urè su821720;L8217;ÉOAffiche Rougs821721;éds brong class="spip">JILouiseAragnestrong>&/, ru dNtard m s envmusiqilsssueLéo Ferré. Ssdn#esé23vmbre ,sdluvgaoups q pdfus,nppcapturésdrt&exursiél,apsue a Gscoapols uls 3réoait.,aes&naonnelriédsftarçaile.rOnm-llsemoiesemérité dea#anFranc,eqiralesémilccruescdeaVichy,udésvde&pèr,=oueddomèr,=ftarçaila821720;#8217;avayantajamaisrreso cé...821721; br> sbr> sPl lepcèséueunves,abrong class="spip">JIChe Guev rtstrong>&/toffrereneexemplsaeontreuru dNslis ssanpadpc#aadiciociasinevtfeasenaonnelriédseppiatriottt s. NéeAr,untas, lleaerurtecipépauéGuatemnlad urmtuvsnt nr#laJacoboeArbenz,dtsppdevtduo#8217;anu(&d sé5 Ctmmn dant, ele séRévoluénne cubaind,ce8217;avtsppbattupauéCg>&oacofease# édicoltur,=dcfMobutu,ucca.,au8217;iaêe léasnacinnéa o Bolivie. br> sLesanaonnelris/ssrdpce z s leq pdvocifès,npplruru d, so taen=me lstemplr csdsl lefssveses admarlor lsedpc#ssatuor lseNord-Améi cains.pCrrtaenl so tame lsallésvjtiqi8217;Éiàsf uernued821720;brong class="spip">JIClub B rtk Obamastrong>&/b21721;éennHaïtr,eetuts letnne.antéàt s rdvcsanouéàt s rd821720;greuedcard821721;,eru snqi8217;ÉOàe a prun ldedeé r lsey,ux br> sbr> Illuoublit.,as sao t raqirasip#csdUSAuso tadpvtduluetureatt.,aeontreuhégémonci el, ta.,aessepoi tle#dfvue éet ome&#e,ascruettfce taqiramilatar d,ao8217;avtsppeo gai ecfpartiecewuraacr aétélre sregarda.,sussdn#8217;anvrigi leoua énaonnelriédsdpcq pdumuvtitàcofeaibuure urptogaèsruuIu ys.IAassi, Eiesteas, juif& esemn d,abrong class="spip">JIEni co Fermistrong>&/, Itairue, qiiuo.,ets le csddeux urstsu(&rôlu #éterminanéPd saoldddénrloppunt.,l#su 8217;ÉOarsentede,l#su 8217;ÉOindustri, nucléarreséaméi cains.pOn re tpajouttrJàunettcflist,, brong class="spip">JIModibr Diarrastrong>&/, lraMairue. Encsulctce t, or re tp,ite abrong class="spip">JIHenry Kisinngerstrong>&/, néa o Aesemngnebsp;:&; brong class="spip">JIZbigdaew Brzezinskistrong>&/e s PglonaisreMrbrong class="spip">JIMadeleineéAlbrightstrong>&/tnasivraesalséTchéetslovaqiie.ILe ptecrerta&étélss leNixsee#raMasattsedd séAffarreséÉriangèrqs aearu dNinflu,nppesalsés ntededmuitiéedu015è susiècll.aBrzezinski acsssvi JipmypCarterdetmmerence,ip ldcneiileleroenalécuraéésnaonnelrl, lleaeétéltfeaseautrera8217;iaarchittes,sdsu a=normalttasnnesdsslrelrénnedeec ld#a Chin,ert&drsRaccordle#dfCamp David. Qlantnà aMaeameéAlbright,arl#dtad easenenté&le tegnme Clietonoetr#es Éttts-Unis àe 8217;ÉOONU. br> sbr> sLaapl usuMdd8217;Éileeasens lestmmesdfisele#dfbrong class="spip">JIMichaël#dtan strong>&/, q pda&étélGvenrnleur-GénérledduéCanada,fuo cdChef d8217;iaÉtttude neIu yséoùnd sémillisele#df#ssacnmiatriotesuo.,eémigréeewuredsslrtis (ladirselesdrt&srueo.,rergdalésdpsuelluràcofeaibutn eeuddénrloppunt.,l#su s rdeociééded8217;ÉOaccubai. Illuo.téédemédeciss,fscca.,s,alnnrrgdt sséàats le csdnirsluxoetnme lsumarresért&dépsiél,acar jamaisr#epCanadaé#8217;avaarefuséu s rdureor ,aauéutétextul#su s rdlieuedpéntissance. Pwurar vesirJàuMaeameéan ,sdo taa8217;iauttaahent.,aàcsa=u tri,cd8217;anvrigi lene re tpêts m s env t r,erureesonsnqi8217;ÉOrlle estdHaïtrueneadpcslng,nFrançaileeesue s mariagevttaCanadrueneapsue#lturalcssonne.aDa lu#strlcu ysaot ursrluinngulier,cmai ddddmuissauedmoiesebee , rlle eû,eé tscructfcéecewuranettcftriplsaupiartenan, ,asidjamaisrrlllàacaienssétedeivpostuler #admairiu drcJacmel. br> sbr> Ns lens leobstas (l,aaurnom d8217;Éiu(&naonnelrismlevcscérle,éàtptiverd#strlcu triu drc#aacnmiétedc,ert&du=u triottt supdtilmmeseeengai gésdda lu#strlcdiaspora,cmai digalqmsnté dflsécmneaibutn ed8217;iaériangerlcd8217;anvrigi l,nsincèr,nt nsxttaahésdàe a cluss0haïtruend.aHaroussdnqiia#8217;avtsppia aHaïtrueddpcslngbsp;:&! Pwuroa.,a#lscdiplomdtescetédirigea Mlcd8217;anONG qiia#8217;avo tanipxffecsnneaniarespect rwuue#s d, dirige tanotseuviee&#otidruen,ert&blrise tanotseufutur,eddau s cfcofet uvde #ssaacin ptesvjtiqi8217;Éiuutbudgeté#su 8217;ÉOÉtttuetnu lormasagevde¬rlcaorceepee ii e br> sbr> JICoestitusinepetsNationlriédstrong>&/sbr> sbr> sLaaCoestitusinepde 1987crstanesonciuad8217;iace,ohére clscetad8217;iace,t gruités,éélaboréeesueunesdncoltur,=milatar d surot sptéoccupéradcfgaranteralsseasnviaèges dea#an oldaossqir, q pt/séàej te aqipli elossadémoccdtii eloàanesrsuplsaacioifférdpce angement.aLeséambigüttésdde nettcfchar r,e csddifféneccps entrecss dvselionsnctéomséeppftarçaile,uso tadpvtduqs aeaf usédlaomp src,eddsdj ris/ss, coestitusinenlris/ssretnu i amasulctologuesd&#iassétedee tano leflirqnlanlsçne. br> sbr> A ursrd8217;anhuipqipc#sussavoes,rno(&ia anec=maisvrivisnCoestitusines (sd ftarçailadon-amesdé, uedftarçailaamesdédrt&ennctéomséietouahé),c#ssaexpertsreeadéchaînent.aCrrsdet /,rlsévérité rstats é Jsipalqbsp;;:C&laaCoestitusinepde 1987,asidpoi tiies le qiantaàn# énaonnelriédsduéPtenent Mr#dflséRépee ii e,éc lle duéPtecrertMasattse,eddsddépsiéldrt&sénat urs,dtsppmuettcfeuracelle de ddéléguéldrt&vice-déléguél,N#dsvmbre ,sd#dflséCwuredsaCasssonne,rdds ntmin dants-en-chef des FA#8217;anHtut&drc#aaPNH, duéPttéses, lvdu citonse,eetutsppil tôsévass le ssdn#esémbre ,sd#8217;ÉOASEC,e csdmarres,r#epCt iilenÉltesorledPseianect,eetc. Qloied8217;iaérnena msqirad saounutrl marécage,e csdcrocodisesredom uve t&uc ldtt tedecsouplssse br> sbr> AflséCwmmesninensénatosaaeddréclmmeseelormél, jd r ntmmn durai ddddsdocon sntserasura énaonnelriédsdudChef dsu 8217;ÉOÉtttuetnc lle duéPtecrertMasattse,eru tôséqiradddsdolrnc,rod saound chasnpeot Jazim t,cé&#ivalt tedecfoiMéàe#syeue s uricioe.aSio#8217;anu(&ouel8217;anautrerdqncesaru dNhautsalonconnenarresédétedoiMéueufaienun,lautrernaonnelriéd, lle#evaltcaêeasecoeeamsé,rno(&suranettcfbasd,cmai dewuraacr adélibérént.,arivmiéalursdNcofcitonses. br> sbr> L &naonnelrismletsppneesr vesdicasinevrneitrut /séepp ouve tncleubq,n#e=u triottt sueneengage snt,aueado edecsoi.&La&naonnelriédsrstaneshésaéage,ealoeleqi8217;Éinec=u tri,redoméi te,ao8217;avtsppenercmnquêtgeuseianectc. L8217;ÉOêeasehumaase#8217;avtsppia acqa’ani é#aît,cmai dcqa’ani éfaie.sbr> Pwuramaépart,ejlsn8217;anaurtis& ucundptoblè séàeêe léuirigéeesueundChef dsu 8217;ÉOÉtttusssbo-croatq,prwurvua’ani étitàdémofeaé,rhorspdpeot J t r,esoneengage sntarwura édémoccdtileete SaptogaèsrennHaïtr.IUnuiatriotecrnfsomme br> sbr> JIPatri,k Elie futasectétar d d8217;iaÉtttuàn# éSécuraééspee ii ec(1994-1995)lss leJIan -Bertai esAristidestrong>&/tsti>. br> Patri,k Elie rstanesomllaborat urotegulitrddpcMtrdialcssonne.ca. sbr> sbr> p>

L />p class="spip">LLrt-au-Prince, ,a23 janvrera1512 br> sbr> p>

JIL(ttss0ounrnt aauéPtenent Mr#dflséRépee ii esth3>p class="spip">LLCrptesl(ttss0ounrnt aposeCorèseclarrent.,a edptoblè sédsu 8217;ÉOexesot clad8217;anu(&Étttude eroituànHaïtrCaloeleqidflséJusticldsrraienbafouél,eeteqiralee#evr adsecémorreureattraienun vaasemoe.sbr> D sémillisele#8217;anHaïtruesuo.,esouffrnt da luessentneisineseatroc,sd#dflsédicoltur,=dcfJIan -ClaunteDuvalierstrong>&/, lrsRnaissssedsu 8217;ÉOÉtttuvidélsuàesonerrmfit.aCrt s,iuesréfugiéa o Franc,eom Minu au8217;iaêe lélibrl,eetei é#8217;avtsppia ai e iétéussdn#esterritor d naonnelr.dChere z 8217;ÉOer tur.sbr> p> <_docume t_1418 ip">_docume ts ip">_docume ts_cqnt r' <

LLAdssoposdde nettcfl(ttss0ounrnt ,pi é#s lealétéuudrrcié u(&autrerdocume té&#iréiane eumdiba Clrncépiarobrong class="spip">JILeslie Pé strong>&/tdèle c ... 10omarsa1510,d urmtmsntéoùe a cltaataophr&éétnt&aavru dNpatt.,l,eeteoùe a den lu Cio(&sural8217;anavesirJsulctce tl ueu ysdn8217;avavaiensa aeontreuatteasppaearu dNgai esnore ,. Oùéenttsp- eeuursrd8217;anhuibsp;:&?rN8217;ioy-a-p-llesa aqipli eschoee #dfssémonctor d da luceadéba bsp;:&? br> sbr> p> <_docume t_1419 ip">_docume ts ip">_docume ts_cqnt r' <
L />p class="spip">LLrasas, janvrera1512 br> sbr> p>

LLEn nettcfpéi od,=orèsepivpiccfuutsouve ,&nore ,uxeso., cruxe&#iadoive tnhésite a otreelsévglontdddpcreptedess0usrr ,vtta écmeitatasinevs sao lu Cio(&du&chcmintssucrsru sE,abruedéventmnt.,,e e aop nnelarisqir.,au8217;iaêe léfor Cdiffénectc=te z cruxe&#iaso tadpmr résneu u yséetéc uxedo taa8217;iauetedecmsntaia leeesue s filtrend8217;anu(e vcclras écfuutloie.aDa lucssentneisines,a#8217;iaobjeconvaéésne re tpreattreqi8217;ÉineNgai esmoeaqirac rtaenl n8217;avhésite.,rewuroa.,ajamaisrà&r vesdie tr. br> sbr> L lutémorgnsgcsaic so.,ets ursrlulcsRbruevtdul. Encattedet /,r#s lerourannelarureeser,ecop seu(esréféneccppiu dNoudmoiesebrenguebalt t,,flsédéassrsonne dpcsulctce tlgénérlee duéPtecrertMasattseobrong class="spip">JIGarrypCt rllestrong>&/t&#iadaosl éjàn#dflséfine#su 8217;ÉOannée&srécédectc. Arsès,plleelrasts ursrlutemplrecfpare r,aepcèséacr alue a precirn#171;nbsp;?Loccent Malqbsp;;:#187;Morwuraessaytrddpcsseflirqnu(esidél.sbr> sbr> p> <_docume t_1403 ip">_docume ts ip">_docume ts_cqnt r' <

LLOnnpouraldigalqmsntéliaseec ldaca.,sgce 8217;iaouvrsgc JIHaïtr,eréievqnt r l8217;anavesirsti>req pdvit.,aes&eotéi luxoÉeisinese#e #anMtis ( des s,iueces ddpl8217;ÉOHop seet luxoÉeisinese#e #8217;ÉOUnirselité d8217;iaÉtttud8217;anHaïtr.ILe liv ,0alétéuédaéésiarobrong class="spip">JIan -Da iel Raenhor strong>&/, ac ldune eetefac,=dcfJIMichaël#dtan strong>&/drt&u( apostfac,=dcfJIMichè s Preras-Louis.strong>&/d br> sbr> sbrpanlass="s'ip">_docume t_1402 ip">_docume ts ip">_docume ts_cqnt r' < sbr> JIStmmnirestrong>&/sbr> sbrong class="spip">JIMichaël#dtan strong>&/d-éPtefac,sbr> sbrong class="spip">JIan -Da iel Raenhor strong>&/d-éIfeaoduction br> sbr> sbrong class="spip">JIChapitsqaIstrong>&/bsp;;:C&Chronci ecd8217;anund cltaataophr&an on,é,sbr> sbrong class="spip">JIS.pCastorstrong>&/d-éLsslrtcasasulécularreséd8217;anund iffic lu eteitauctiontnaonnelrlsbr> sbrong class="spip">JIE. Msthusnestrong>&/d-éLsévulnérlbiltté ocils rennHaïtruàn# évilele d éismlsbr> sbrong class="spip">JIN. B rr(ttcRet L.aDaleaustrong>&/d-éHaïtr,eigalqmsntéterrpédu eyclonessbr> sbrong class="spip">JIa. a. Wagderstrong>&/d-éLs&tnemblqmsnté dfterrpédu 12 janvrera1510bsp;;:C&ueadésaatareetevisilms br> sbr> sbrong class="spip">JIChapitsqaIIstrong>&/bsp;;:C&Raconttrartumontserbsp;;:C&lqs médiasetnd&#elonnesbr> sbrong class="spip">JIP. Robrtéstrong>&/d-éTémorgnsgcbsp;;:C&CommeseemofeasdnaupreattcdurmtrddJle éismlert&srsacneiéqir.cesbsp;: ?sbr> sbrong class="spip">JIa. M.bsp;: Saint F s rstrong>&/d-éLséprecirnhaïtruend faceC uxevictim ledue éismlsbr> sbrong class="spip">JIV. Gosnestrong>&/d-éLs uriddN#dsvmots,r#epchocressephotossbr> sbrong class="spip">JIA. Robrtéstrong>&/d-éMauniteéprecir br> sbr> sbrong class="spip">JIChapitsqaIIIstrong>&/bsp;;:C&Lséscède haïtruend eu aedecmaenedue éismlsbr> sbrong class="spip">JIM.bsp;: Chaenréstrong>&/d-éTémorgnsgcbsp;;:C&OùéenttspnHaïtruu(&anoapsèsdlcf éismlbsp;: ?sbr> sbrong class="spip">JIL.aHurbonstrong>&/t- Religines,apolctce tdetsmtrdialcssonnerennHaïtrsbr> sbrong class="spip">JIa. E. Saint Paulstrong>&/d-éLséeociéédecnvias0àu 8217;ÉOértmenrnd8217;anund csi"elhumanrtarresbr> sbrong class="spip">JIa. C. Fignoléstrong>&/d-éDé sntsalcssonnebsp;;:C&opiortunités,élimitrénnedeetfnt érarctc=sbr> sbrong class="spip">JIF. Grünewaldstrong>&/d-éL8217;avaidelhumanrtarrerennHaïtrbsp;;:C&qlllebilae dpux saoapsèsdlcf éismlsbr> sbrong class="spip">JIP. Salignonstrong>&/d-éHaïtr,eRépee ii ecdlsdONGsbsp;: C&a8217;iaempirelhumanrtarrerenn&#elonnesbr> sbr> sbrong class="spip">JIChapitsqaIVstrong>&/bsp;;:C&Éléme ts rwuraunearteteitauction/refo dasnnesbr> sbrong class="spip">JIE. Dosnsmtrdstrong>&/d-éExesotrad saolds cltaataophrsbsp;: C&souffranc,ert&ent Mitésbr> sbrong class="spip">JIP. Chansonstrong>&/d-éHaïtrbsp;;:C&lq Bne dieueesp-llevaltmqnt bnebsp;;:?sbr> sbrong class="spip">JIM.bsp;: Msthisu,eR.tan cJacq tsuetJD. Déi vsisstrong>&/t- Ren liueceeeteproc,siu=rcrédt, ls dyname&#esbsp;: C&drsRoutil adrarteteitauctiontiwurelds jeusasuHaïtruessbr> sbrong class="spip">JIT.pCalvot, S.pRizkpetsN.cHerlqmt é-Zorrtchackstrong>&/t- Nvenraufregardussdn#eshandicapbsp;;:C&ueerbeesdomanrèr,edraréievqnt r l8217;anavesirsbr> sbrong class="spip">JIC.cHectorstrong>&/d-éLsslperspectrv ledeol érteteitauction/refo dasnnebsp;;:C&rebatts lds cletrsbsp;;:?sbr> sbrong class="spip">JIC.pRidoréstrong>&/t- RecofcilitrdHaïtrCac ldsaddiasporabsp;;:C&ueapeéarllmséàauneartfo dasnne dea#aneociéédbsp;:&? br> sbr> sbrong class="spip">JIChapitsqaVstrong>&/bsp;;:C&Réflexionrewuraa ursrd8217;anhuiprt&ddmaensbr> sbrong class="spip">JIP. Desmanglu=strong>&/t-éTémorgnsgcbsp;;:C&Réievqnt r le&système #ddst tésbr> sbrong class="spip">JIE. Kolo Favotmestrong>&/d-éLsslact, ls locaux laisséc ewsdnompp eedeol érteteitauctionbsp;: ?sbr> sbrong class="spip">JIa. a. Moisnptstrong>&/d-éL8217;avéducsonne ewsdnrousbsp;: C&usiorrtédd séusiorrtéc ewsdn#eodénrloppunt.,l#8217;anHaïtrsbr> sbrong class="spip">JIM.bsp;: Redoestrong>&/d-éLséi elonnePfo crèr,bsp;;:C&ueaaspect deol érteteitauction q pd eére tpêts ss l-elonmébsp;: ?sbr> sbrong class="spip">JIG. Doséstrong>&/t- Créursd séemploisretepromr er adeunvenraux métrerssbr> sbrong class="spip">JIa. a. Moisnptstrong>&/d-éL8217;avéducsonne ewsdnrousbsp;: C&usiorrtédd séusiorrtécsbr> sbrong class="spip">JID. Desmanglu=strong>&/t-éLesédéfisd#dflsédiaspora haïtruend #dfSu sslsbr> sbrong class="spip">JIM.bsp;: Preras Louisstrong>&/d-éPostfac,sbr> sbr> p>

L />p class="spip">LLDé sre ,a1511 br> sbr> sIC8217;avtsppvalt,c#sussavoes=usi"&ueasérrdux r(tarduec ld#8217;ÉOacsulriéd.IPwuroa.,,e e aielormasineseom Minuait.,ae8217;iaartiver,eetei éfa sbruedr ntentîeasensséfa ,s. Essay ledo cddpcreptedess0 cfcourséde¬rlccmmielicasnne. br> sbr> JIAc ld#a omllaboratnne deaHarrypJoseph deaHaïtr-Focusstrong>&/sbr> sbr> L &Masattsedd c#aaPtenent cp,fe argéoddsdHaïtruescvica.,0àu 8217;ÉOérianger, Mrbsp;;:brong class="spip">JIDa iel Surelicdstrong>&/, a tevéléeqi8217;Éinec=demn du lormrl#dtadéédedépo écfréclmmeseepsue a Franc,eaupaèsruuInvenraufivenrnlent.,rhaïtruedewsdnqiralesé s,iueséutenent Ms,éMM.bsp;: JIan -Bertai esAristidestrong>&/teMrbrong class="spip">JIRenéaPtevalstrong>&/, soit.,amisdàe a dasrosisnne dea#anJusticldftarçaile.rÁ&ennctor d sdomasattseden&tt rnée&offic rl#dtàu 8217;ÉOérianger, #anJusticldftarçaile i8217;avaeprê/séàer nevr a s rddérosisnne relrénveC uxeact,=rcrimnntls ntmiisdpsuelldru sst séchef de ga clesaBélékou, brong class="spip">JIAmarledDuclonastrong>&/, so le curJptenent cp. Amarledalétéuurrê/é&le 8 Stptdre ,a1509pauéntmplsxlétt ris/ii ec"Casadd(fCampo"ad saoLséRomn a,tàu 8217;ÉOEsMr#dflséRépee ii eadomen caindéoùni éptedtnt&refuge so le crnom dec"BerthondéJwlccocurJ".ILe fugisifuadéédedéet uvrsdet / ru CiursdNmoisdpsuela Dirtesnne NaonnelrsrdepCt trôlu #dsvDroguesd(DNCD)ucca.,au8217;iaêe léliv éC uxeauiosatésdftarçailec ewsdnsavrrésumélarsutecipatnne àpa8217;iaenlèvent nssunvie#su 8217;ÉOasnacinnaM,r#ep31nMtia1505,duentrsul honorti d depFranc,, Mrbsp;;:brong class="spip">JIHenri Paul Mourallstrong>&/. br> sActivrnt.,er n re édpsuela pwlccqnhaïtruend ewsdns ( emelicasinevrrésumélada luesseact,=rd8217;iaenlèvent n,edpciéqirstrsonne dpcsersoeneseetad8217;iaasnacinnaMs, lleaerudévetedn#eséfnletluessehtmmesddcfJIMarin Adesésolstrong>&/. br> sAc ld#a drrnrèrq tevélsonne faiteàesue s masattsedDa iel Surelicd, or i8217;avattedeJàunerqilsdlsdhtmmesdtaopdru sst sc ewsdnêe léjusticillms dennHaïtruaiiesnppssdn#esébordle#df# éSeineéewsdn#euràcofc rt lugubs àelséru dNgai eddsttisfacsnnesdsslauiosatésdftarçailec.sbr> sbr> p>

L />p class="spip">LL15 octoe ,a1511 br> sbr> sJILa&Pulctce tlGénérlee vit.,ae8217;iaêe léaeprvenéedpsuela Chare ,addsddépsiélstrong>&/. br> sSamedi masie àp8h19,aepcèséonzqnhru ,sd#rudiscuslionsnent nees,r#eppttjesaducDr. GarrypCt rlle alétéuucctptédpsue81ddépsiéldssdn#esé88é&#iréétneseepsenents orsaducvotl,eete7 abstfdtn s ssbr> sLeéPtecrertMasattseoaerem(rciéela Chare ,aba leeuedr ntent sst séqirac ttcfueprvbionneane coestituaiensa aueae a c-seing ewsdns ( ivenrnlent.,repplui-me l. Ilea datevs lr ate ompp eedessremarquelueturentmin dasineseévoquélsuaosdN#dsvdébtts,eetei ée8217;avtsppaffirmé #éterminé àeentreasedess0x soitôsélanlrsrdlétâche &#iaa#iainaoretitàdésormais.pCop sets le csdobsssvat, ls dea#anvcclhaïtruend, i éetitàoaopdbruedà&qlllepoi tdlesrsuplsacmp s çai Càasdolrcirrad8217;iaattedess0ceemtmeseeenfie favotllms.sbr> sbr> p>

L />p class="spip">LL14 octoe ,a1511 br> sbr> p>

JILa&Pulctce tlGénérlee duéPtecrertMasattseoaeprvenéedauéSénatsth3>p class="spip">LLCr jeudi 13 octoe ,a1511,e crnoenraufPtecrertMasattse,elcfJIDr. GarrypCt rllestrong>&/tasso mis& uéSénatc#aacnmiosisnne deas ( Cabind masattérrdede,lftnt&aqctur,=dcfl8217;iaédo cédd c#aaPulctce tlGénérlee duéGvenrnlent.,. Arsès&aqctur,,e crnoenraufPtecrertMasattse alftnt&faceC uxeréacsnnelueturérodeiv uxenore ,usesd&#elonnes rt&ddmand,sd#ruutecilinese#es&sénat urs.IUnuexercice q pda&duréeecèséueu8nhru ,sdrt&s8217;avtspps8217;avachevéarsele3h15 durmasie esueundvotl favotllms.éLséeéanc,eaura&duréeauftotaleecèséueu12nhru ,s.sbr> sbr> p>

LL#171;nbsp;?L...jtice cca.,auclras sdnaupvotl,ejc=demn du aufPtecrertéSectétar d dcfenenernaqctur,=dcfl8217;iaartecle 158dd c#aacoestitusinebsp;;:#187;Mosédéassrétan cRodolphr&Joazil,,e crPtenent Mr#uéSénat.sbr> p>

LLJI[artecle 158]sti>r#171;nbsp;?LLeéPtecrertMasattseoenRaccorduec ld#crPtenent Mrchsisitn#esémbre ,sd#eas ( Cabind masattérrdede,lseepsenentee#evantJ#r Parlent nsxfine#8217;ioobte undvotl de coefnanc,essdnsavdéassrsonne dpcsulctce tlgénérlee.ILe votl adlieueuutscrusie eee icéetéàalsémajorrtédabsoliradddchacnec=desddeux (2) Chare ,s.aDa luaedcaiéu8217;iauevvotl de no(&coefnanc,epsuel8217;Éinec=desddeux (2) Chare ,s,dla=urmcédurddrentmit cp.bsp;;:#187;M br> sbr> Arsès&aqctur,=dcfl8217;iaJIartecle 158sti>,e crPtenent Mr#uéSénat a=urmcédénaupvotlbsp;: Csbr> sI#171;nbsp;?L...m(rci, jd rureesleeqidflsémajorrtédabsoliraaurnirslur#uéSénat #dflséRépee ii eatsppde 16,flsédéassrsonne dpcPulctce tlGénérlee duéPtecrertMasattseotsppmttt eupvotl,ecruxe&#iaso taiwur,élev z sémain s8217;avllevs lerlaî,. PtecrertSectétar d, faites cfcoferôlu ewsdnmoi,p lrci 16 ewsdbsp;:&; cruxe&#iaso tacofeas,élev z sémain s8217;avllevs lerlaî,, 4acofeasbsp;:&; cruxe&#ias8217;iaabstane.ant,élev z sémain s8217;avllevs lerlaî,, 5 abstfdtn s sLsédéassrsonne dpcPulctce tlGénérlee duéPtecrertMasattseobrong class="spip">JIGarrypCt rllestrong>&/ttsppadoptél. Mlrci.bsp;;:#187;M br> sbr> LeéPtecrertMasattseoCt rlle #eval&srueoum(ttss0 urmêmeNexercice #evantJ#a Chare ,addsdDépsiél,aceevesessdi [saufcrepor Ciparévu]. S8217;avlleobtiln/ nedvotl favotllms,e crnoenraufPtecrertMasattse epp oedcabind masattérrdedpouraoseeenfie, sntseraenalonconne. br> sbr> Cnmiosisnne dudcabind masattérrdedduéGvenrnlent.,rMsrpelly-Ct rllebsp;: C& _out">http://www.haitilibrl.ntm/artecle-4017-haiti-sulctce t-cnmiosisnne-du-cabind -masatteriel-du-ivenrnlent.,-msrpelly-ct rlle.htmlp>a sbr> sbr> p>

L />p class="spip">LL28 aoûta1511 br> sbr> p>

JIAgrecultur,bsp;;:C&Leepoi tdsura élécuraéésaltmqntar d jtiqi8217;Éiueddé sre ,a1511sth3>p class="spip">LLÀ côtédd séuhédomènesenaour,lsddo taa,sdrffetsdsura élécuraéésaltmqntar d p uve t&sq tevélrradramsone tsupwurelds rlusndéielis, llefa sx soiJmfdtn ner #adeiousonne sulctce tlq pd eéfavotileeesaoldddénrloppunt.,l#suntneisinesepivpiccs& uxeieveloncieme tséetéàalsécrédtine dpc#senraux emploisrdurllms . Aucude sulctce tl eére tpêts définiu uedvirad8217;ÉOaentrJlesé grecult, ls qiiuo.,eperduéeo gai ecfpartieclds rla.,ssinese#e asnetempl.ssbr> sLa tecolttcdurasnetempladpmr ru uedgénérle failmséàariavselessssqirats é le sategn ledueu yséàalsésuiM dea#aneén re leeueregattséea otreemarsaeépjtie. Enccnmiartis ( des ci e drrnrèrqs senées,ac ttcfeiousonne asesgeseséeund failmsédasronibiltté enerrmduiMssaltmqntar ds locaux d saolds zoneselds rlusnxffecséespomp sud saolds déiarteme tsé#uéSud821708vtspp(Cô/ssrdpcfer, Gai e821708vGositrartuAnse821708và821708vPitsqs), duéNord821708vOutspp(Baiu drcHuend, Boretrdopulcs), duéNordp(Bahne,rPignon,eeteRanq pt/s),ert&du=Nord821708vEsMr(Ferritr,sFor CLibrtéé, Territr821708vRougs,pCaracol),eiarticuliè dmeseeen aoûtae,lseptdre ,.sbr> D saolds tegn ledueSudeoùe ds rla.,ssinese#e asnetempl o.,resrtsrlllnt.,rré soi,alsseasnxdd séusmduiMssaltmqntar ds locaux omp sualemaïsts8217;iaxffichentaàn# ébaisss. Pareexempls,Pd saol éregn dd séCayss, coesidéséeacop sel8217;annec=desdru dNgai eds zonesepaoductriccs&durmaïs,dla=marmiM dea6 liv ,lutsppras écfdea68 iverds dennjtilletéàa50 iverds deuddébutcdurmtiiéu8217;iaaoût.ILe haricotanoi lacnenu&ueerbaisssPd saol éregn dd séGonaïvss, maisri étsppennhx sosPd saol éregn dd séCaysstut&drc#aaGai e821708vAnseeuedrtis ( des sem s envcourséd saolds mt éagdesdhuments.aLeséusmduiMssimporoéspomp sual rizeete Samaïstsontaàn# éhx sosPsura épl usuMddds marchés.pCrttcfuugmqntasnne dudutix lsppduséàauneatransmisCio(&du&corsdN#dsvusmduiMssssdn#esmarchésmtrdial,dxissirqi8217;iaàn# ébaisssaducvolum,=imporoé.aSio#a tsdet ctddudutix dudrizeseémaintiect,eellu ewsdal&aggiavsea 8217;iacelécuraéésaltmqntar d d saolddu yséau&corsdN#dsvusmchaiesemtiiéu saol émes ru oùe ddrizecoestitucfl8217;iaaltmqnt&drcbasd&drc#aapwpueasnne. br> sAc ldcrttcfuugmqntasnne dudutix dudrizeetad8217;iaa i amassmduiMssdrcbasd&omp sual sucr,,e crpr er ad8217;avacha,aessepauv ,luom Minu ra #dddimnn tr.tSeloedl8217;iaIestitusaHaïtrueddpcStasnsone tsuetad8217;iaIelormasii el, lcftaux d8217;iaceflsonnerenng ncient nsxenuel i8217;avaeproe pde 10bsp;;:%. Enco i a,pl émtent e locala,pl éiverds,reeadéetecieepsuerureor deuddmllar.pCr &#iaentraîn ra un,lapeteciasnnesdsslcoûtdN#dsvusmduiMssimporoéspdo taa,sdusmduiMssaltmqntar ds pwureldsqllls envirne dpc50bsp;;:%N#dsvbesoiesedrc#aapwpueasnnetsontaimporoés. Ts é fo s, or obsssvqnu(esbrong class="spip">JIuugmqntasnne dudmt éa.,a#lscriansfertsrdeaf usédlalsédiaspora rselelu u ysstrong>&/. De 80émillinese#e dmllar dennjtina1510,dledmt éa.,atsppras é àp88émillineseennjtina1511, soienun,laugmqntasnne de 9bsp;;:%. br> sbr> sJIMileeàaursrN#dsvusmjecsinese#e lécuraéésaltmqntar d jtiqi8217;Éiàddé sre ,a1511strong>&/bsp;;:C br> sbr> sJI JINord821708vOutspsti>rstrong>&/bsp;;:C br> sbr> sLes sem s tardifsdrffectuéldrnnjtinaso tairom(tteurséd saolds cmmielesedrc#aapwnete occent Malq eumdiiarteme t.aLesétecolttsddébuteaoseerselelaumn821708vseptdre ,. DusfoiMéueu#aapseltsoa.c dea#aneén re leeau&corsdN#dsvrivisndrrnrèrqs stis (laeMéueu#aapse eedesscultur,s,alsseaauv ,lureattro taen=csi"el(Phasd&3)een aoûtae,lrnfstptdre ,ad saolds cmmielesedrcBaiu drcHuendaeMéueuBoretrdopulcs. Entss0octoe ,art&dé sre ,a#adeiousonne i8217;avamélinr ra etr#es aauv ,luras sdontaàn# éphasd&2.aDa luaafpartiecorrd Malq eumdiiarteme t,a#adeiousonne tsppsueliblqmsntémbaies rd,cmai dseémaintiectlrn821708vdeci usedrc#aanormals.sbr> sbr> sJI JINord821708vEspsti>rstrong>&/bsp;;:C br> sbr> sSields rluiesdo.,efavotiléoldddénrloppunt.,l#ssscultur,séd saolds mt éagdesdhuments,a#aneén re leeaairovoquée curJpse eeà Ferrié,sFor CLibrtéé (àpa8217;iaexceptine dea#anrlaind #dfMarietroux), Territr Rougs,pCaracol etrTrou821708vdu821708vNord),eirglongea Mdxissir#anréi od,=d,=jonconne,d&#iassedeJfinegénérleemeseeen jtie. Àfparti adeujtillet,Pd saol ézonee#e alaind uedmonocultur,,alsserizrèrqs so taen=csoissanceNgaâc àelsémt ééq eumnirslur#8217;iaelur# saolds tivrèrqs etr#es lagnes.aLeséusixeso., stllms dmai deu dNélevésnqi8217;ÉOrnnjtilleté1510.sLsémajorrtédd séaauv ,lureattro taen=etectrttél(Phasd&2)een aoûtae,lseptdre ,. Ac ld#esétecolttsdattedeuedN#dsvmo éagdesdhuments,aun,llégèrq amélinrasnne dea#aneiousonne se tpi8217;avopére a otreeoctoe ,art&dé sre ,.éLséproximitédd c#aaRépee ii ecDomen caindtoffrerdrsRopiortunitésdd criavailee,adpderpvtduluponcollls aosdN#dsvjourséde&marchés [lurdi etarssessdi] à d sémillisele#dfsersoeneseq pdtravselentJ#a frontrèrq.sbr> sbr> sJI JINordsti>rstrong>&/bsp;;:C br> sbr> sPsssqirats é ol éregn dduéNordpéétnt&frureéedpsuela eén re leeq pda&r(tardé les sem s durasnetemplbsp;:&; crsndrrnrseleo taiupêts en tiéldrnnjtinaec ld#8217;ÉOartivéc=desdru its.aLesézoneserépsiétsdaridds ntmircBahne,rRanq pt/s etaPignonuo.,eétéelds rlusnxffecsées.aLeséuauv ,lueeadéelac,seerselelauRépee ii ecDomen caindtouad saolds cmmielesedrcQuartier MosneaeMéueuLimonadd àelsér n re q eumriavail. Illuso taiwura épl usuMden=csi"el(Phasd&3),cmai dac ld#esétecolttsddurmaïsert&du=sorghoe&#ias8217;iaén l nero taene léfinfstptdre ,aeteoctoe ,,e curJeiousonne altmqntar d devaltcai8217;avamélinr r. Illustro taen=Phasd&2a otreeoctoe ,art&dé sre ,.sbr> sbr> sJI JISud821708vEspsti>rstrong>&/bsp;;:C br> sbr> sL éregn dduéSud821708vEsp ldigalqmsntésouffrnt dea#aneén re leersdet / #anréi od,=d,=rla.,ssinea otreemarsaeépjtie. Lsslperttsddurmaïsert&du=haricotaso taelonmées àeenvirne 50bsp;;:%N#a luaafpl usuMddds zonese#e asoduction. Gai e821708vGositr,uAnse àePitsqsvttaCô/ss821708vde821708vFeraso talds cmmieleselds rlusntouahées.aLe=haricotatsppaaéasne,ip leésourc,edderpvtdulupourJlesé grecult, ls #8217;ÉOAnse821708và821708vPitsqsaeMéueuGai e821708vGositr.éLsépse eede nettcfcultur,atsppevaluée àeru dNdeu30bsp;;:%N#a lucesadeux drrnrèrqs cmmieles,eréduist sé#8217;ÉOaccèsdd séaauv ,lu uxealtmqntssdrcbasd. De ru d, l éregn dd aCô/ss821708vde821708vFeraalétéutouahéedpsuela tempê/séEmilaeeq pda&sdetmingéelds fruiMssenerrmducsnnes(avocatséetéare ,sdvésaéablts).aLeséuauv ,ludeucssentmielesestro taen=csi"elrsdet / #ermtiiéu8217;iaaoûtaeMéueustptdre ,,cmai dewurrtneseevr a s rdeiousonne i8217;avamélinr ra otreeoctoe ,art&dé sre , [uedl8217;iaxbss.c deaptoblè sseclimasii el]aenalac uredsslrecolttsddurharicotattad8217;iaa i amacultur,sésemés dennjtilletéetéaoûtaà Bellu821708vAnseeutuAnse821708và821708vPitsqs.aCrrsdet /,rCô/ss821708vde821708vFeraom Minu ra àeêe léen=csi"eljtiqi8217;Éiàdlséfine#sudé sre , qiandrcmp s c ra la tecolttcdursorghoert&du=utiié,t go.sbr> sHL/aHaïtrLibrl / FEWS NET/ CNSA sbr> sbr> p>

L />p class="spip">LLrt-au-Prince, ,a23 aoûta1511 br> sbr> sJIBulletinfspecial # 15 durmardia23 aoûta1511 btrong>&/sbr> sbr> p>

JIAlse ee rougsepsuerureor d aux omneisinese#e eyclone duéPlae NaonnelréueuGelonnePdsslRisqirsee,adpdeDésaatarsl(PNGRD)sth3>p class="spip">LLL8217;avœlle#ee 8217;iaouragae Irènee#e catégorrd&2asural8217;anén l#erSaffir-Simplne irureorvenràpourJl8217;iaceloa., àeru dNd8217;anund cqntarnee#e kilomèt ,lu uanorddd c#aacô/sanorddd8217;anHaïtr.ILesémbnacesarsuerureor deux omneisinese#e tempê/ss so.,ets ursrludepmttt ewsdnroué le sacô/ssrnorddd8217;anHaïtr.I br> sbr> s Endrffet,tàu1 h pm0ceemardia23 aoûta1511, Jl8217;iaœlle#ee 8217;iaouragae Irèneealétéulocali é àp20.7e#egrésedrc#atitudsanorddete71.2e#egrésedrc#g>&itudsaoutsppsoien170 kmu uanorddnord-outsppdsaOianamenthr,e140kmu uanorddnord-lsppdupCap-HaieieeaeMé260kmu uanord-tsppdsart-au-Prince, . Ileeeadéelac,tàu17km/h env irtesnne outsppnord-outsp.ILeséveses maxésoufflentaàn160 km/h ac lddsslrtfalcsRbrueuru dNsupéi ru ,s.ILeséveses d8217;iaouragae soufflentamaintenanéPd saou(&ray pdsa85 kmuàfparti adu sntse etr#es vqntssdrctempê/ss suraun&ray pdsa335 kmuts ursrluàfparti adu sntse.éLséprecinne sntsaleémes réeatsppde 977 hectopascals.sbr> sbr> s #171;nbsp;?LIrènebsp;;:#187;More sptmduirea otree100aàn150émillimèt ,lud,=rluiu uedalaind,cmai dac ldd séexcédectsd#ruutecipitrénnedessdn#eséterraiesemt éagdeuxedsslregn lenorddete sntse d8217;anHaïtraa ursrd8217;anhui.IUnealargsezonee#e atecipitrénneeeeadénrloppantneuessddd c#aaRépee ii ecDomen caindtewurrtntuatteasess0igalqmsnté l éregn dssdddueu yséceteepcès-midi etacecsoir. br> sbr> s Enccneiéqir.ce,dledSPGRDémaintiectlceemardia23 aoûtaa1511dledmnirslur#e vigilrnc, rougseduéPlae NaonnelréueuGelonnePdsslRisqirsee,adpdeDésaatarsl(PNGRD) ( i.e.érisqir d8217;iacmpactad8217;iacet neitédviolentaànextrême)&faceC uxembnacesarseltsoa./ssrdpcforttsdru its,l#suntupr#e ve t,aac ldrisqirsed8217;iaéboulqmsnts,l#sug ncient nsdeéterraiecetad8217;iaceo dasinesed8217;iacet neitédrougsepwsdnrousenssédéiarteme tsénotamnt.,a ednord-tsp,a ednord,a ednord-outsp,r#epcefeas,él8217;iaoutsppesé#8217;ÉOArtibonct,.sbr> sbr> sLe=CNMl#suntfc rt ec ld#crSPGRD, l éDPCvtta éSEMANAHrent rditn#esé opérssinese#e cabo,sgcessdnroué c#aacô/sanorddd8217;anHaïtrljtiqi8217;Éiàdnvenrl ordse.éCrttcfmes ru deureatrictiontiwuraltcai8217;avétedess0ssdn#esécô/ssrssddete Sagolf dea#anGonâvrasipo8217;avtsppnéc,siar d.sbr> sbr> sLe=CNMl#suntfc rt ec ld#crSPGRD, l éDPC,él8217;iaAANpesé#8217;ÉOOFNACrent rditnigalqmsntéles volssenerrmvenan, éetéàadrstasasnnesdsslaésoportsé#uéCap-Haieiee,pdsart-aude-Paixee,adp Hce,heljtiqi8217;Éiàdnvenrl ordse.é br> sbr> sJICt irgd sstrong>&/bsp;;:C br> sbr> s LedSPGRDétta éDPCvdemn duntaàn# épwpueasnnetdds zoneseàdrisqirsed8217;iaceo dasine,ed8217;iaéboulqmsnts,l#sug ncient nsdeéterraiecdeureapecttrJleséct irgd sssunva./ss.sbr> s * SedmtesirJàul8217;anénoué c#dsvmbsiagcsamétéo.sbr> s * M(ttss0horspd8217;iaelurot Jce q pdre tpêts sdetmingéeuedcased8217;iaceo dasine.sbr> s * Rejoasess0votrlcloge sntaoueleslabsi"&sûrluingdalésdpsuellslauiosatésdlocalaluessentmitésddéiarteme taux br> s * Ct iolentrJlesétoieu ,sdrn tômséepplapmttt àela terrerdrsRtt.,lséd saolds campl.sbr> p>

LL· Se ateiarureàeévacuuresipnéc,siar d olds zoneseexpo écs& uxeieo dasineseeppg ncient nssdeéterraiebsp;;:C&(alaindseieo dablts,ébordle#dfmtr,uraviles,erivrèrqs, flrncdN#dsvmo éagdes,eetc).sbr> · Nedtravselerolds tivrèrqs en=csue so le ucundptétextu br> s * De i8217;avabrite a odlieux&sûrluàJl8217;iacetéi ru N#dsvmtis (l,tloieN#dsvfenêt ds losdN#dsvoragcsaviolents.sbr> sbr> p>

LLTalot BERTRAND, Ing-Agr. br> sChef dsuSssvic deaPlaeificasineve,adp MobilttasnnesdsslReci urcc=sbr> sDirtesnne d c#aaPttésesnne Cnvias0(DPC)sbr> sMasattèr,=dcfl8217;iaIetéi ru Ne,adpdeCmlltesivitésdTerritosaaedsl(MICT)sbr> s(509) 3733-5953 / 3472-6092sbr> p>

L />p class="spip">LLrt-au-Prince, ,a3 aoûta1511 br> sbr> s_docume t_1305 ip">_docume ts ip">_docume ts_cqnt r' <rpan/sbr> p>

JIIelormasine precirn#117;1;a1511-509p-pCop unci é #2 Alse eeeyclonii ecrougse uxeforttsdru itseet luxofortsévqntssth3>p class="spip">LLrt-au-Prince, ,amardia2 aoûta1511- 06h00a#117;1;asbr> sbr> sLe=brong class="spip">JISectétasaateuseianectl#sugelonnePdsslrisqirsee,adpdedésaatarsstrong>&/, #suntfc rt ec ld#crJICsntse naonnelréueumétéorglogiestrong>&/t(CNM), l cp,feeemardiamasie,fl8217;iaalse eeeyclonii ecrougse rsès&un,llégèrq accélérasnne dea#antempê/sétivpicaedrJIEmilystrong>&/, néen# évilele rsele7:00apmuàfproximitédd c#8217;ÉOArc a tiieais.sL étempê/s,sdo taae sntse esppsieué ewsdn#eomtmeseesura épartiectsppaaémursd séCaraïbes,eà 390 kmu uassd-tsppdsart-aolRico,eeeadéelac,tàuu(e vctecirndsa26 km/h rselel8217;iaoutsppeséiwuraltcatouaher #adRépee ii ecDomen caindteuisrHaïtrCd saolds usmchaieds 24tàu48nhru ,s. Eele foiMépesursd sémbnacesarseltsoa.cssrdpcforttsdru its,l#sufortsévqnts ac lddsslrisqirseaccrused8217;iaéboulqmsnts,l#sug ncient nssdeéterraiecetad8217;iaceo dasinesesural8217;an neemblq eumu ys,euedrtis ( depa8217;iaextrêmeévulnérlbiltté drac rtaenl déiarteme ts.sbr> sLe=Sectétasaateuseianectl#sugelonnePdsslrisqirsee,adpdedésaatars (SPGRD)étta éDirtesnne d c#aaPttésesnne cnvias0(DPC)uo.,eacsnvéolddCsntse d8217;anopérssinese#8217;anurgs.c naonnelréeteepeesle / #anrwpueasnnetdds zoneseàdrisqirsed8217;iaceo dasine,ed8217;iaéboulqmsnt,l#sug ncient nsdeéterraiecàureapecttrJleséct irgd sssunva./ssbsp;;:C br> sbr> s Se tesirJàul8217;anénoué c#dsvmbsiagcsamétéobsp;:&;sbr> s M(ttss0horspd8217;iaelurot Jce q pdre tpêts sdetmingéeuedcased8217;iaceo dasinebsp;:&;sbr> s Ct iolentrJlesétoieu ,sdrn tômss etr#es tt.,lséd saolds campl (jtiqi8217;Éiàdeeemardiaepcès-midi)bsp;:&;sbr> s Ct ititucrolds tésssvqssaltmqntar dsbsp;:&;sbr> s Se ateiarureàeévacuuresipnéc,siar d lds zoneseexpo écs& uxeieo dasineseeppg ncient nssdeéterraiebsp;;:C&alaindseieo dablts,ébordle#dfmtr,uraviles,erivrèrqs, flrncdN#dsvmo éagdes,eetc.bsp;:&;sbr> s Nedtravselerolds tivrèrqs en=csue so le ucundptétextubsp;:&;sbr> s S8217;avabrite a odlieu&sûruàJl8217;iacetéi ru N#dsvmtis (l,tloieN#dsvfenêt ds losdN#dsvoragcsaviolents.sbr> sbr> sLe=Système naonnelréueugelonnePdsslrisqirsee,adpdedésaatars,aec ld#8217;ÉOapp pdde arsutenarreséent rnaonnelux,erenforc,elsémtbilttasnnesewuraaccnmiagner #adrwpueasnnethaïtruend.aLpdeCmordasasnnesddéiarteme tal,s,alssentmitésdntmielluxee,alocaux,dxissirqilsles sap, ls-vglontarresédedla=urmésesnne cnvias0so taen=étttud8217;analse e,CaloeleqidflddCsntse naonnelréueumétéorglogieeom Minu aàssunvreuattentivrnt.,ea8217;iaévolusnne dudsystème eyclonii ecrwuraenaielormer #adrwpueasnne.sbr> sbr> sPwuraru dNd8217;anielormasineuntfc rnt / #anmétéobsp;:&C br> sba href="http://www.meteo-haiti.iven.ht"lass="spip">_out">www.meteo-haiti.iven.htp>a sbr> sba href="http://www.meteo-haiti.iven.ht/vigilrnc,.php"lass="spip">_out">http://www.meteo-haiti.iven.ht/vigilrnc,.phpp>a sbr> sbr> p>

L />p class="spip">LLrt-au-Prince, ,a18njtilleté1511 br> sbr> sHierasoir,JI LénorddFortuné #171;nbsp;?LAzorbsp;;:#187;Mstrong>&/, e antru Ne,atambt rin, lvdu groupdrJIRtcasa Mapour#e Azorstrong>&/tassedeuel8217;anâmdtàu 8217;ÉOhôpitrl B rntrddMevsaepcèséacr arffectué&ueaspectacle da luaedcadrerdrsRfelonvitésdd clséfê eede Mo taCarmel. br> sbr> sGnbsp;?LJ8217;ÉOae lcftambt r da lua8217;anâmdtepplapmusiqirad saoms denérarllesbsp;;:#187;ModixiMéAzor.sbr> sbr> sLe=groupdrGnbsp;?LRtcasa Mapour#e Azorbsp;;:#187;Moéétnt&uirigéeesueLénorddFortuné #171;nbsp;?LAzorbsp;;:#187;M, e antru Ne,atambt rin, lvq pda&appsutenuéàadrenore ,usesdlormasinesedc JIrJIkonpastrong>&/tsti> (do taSS OndaeMéScorpio) our#e JIfolkloeesti> (troupdrBaks lru), cca.,auclflirqnpartiecdu groupdrGnbsp;?LRtcasa Kanga #ddWawabsp;;:#187;M.aDa luaes senées 90,aportédpsue#eomtuvrnt.,eJIrtcasastrong>&/, ee=groupd,p lnédpsueJbrong class="spip">JIucq tsuMauriccdFortéséstrong>&/,rGnbsp;?LWawabsp;;:#187;Mda&sdtreasisd#dfurser #adbrong class="spip">JImusiqiravodoestrong>&/deeuntfc rtbsp;;:C&ec ld#ui,ri étsppras é irtesent nsdu JIhouelortsti> (templsavodoe)éàalséscède.asbr> sbr> sLe=succèsdneccofeaédpsue#eogroupdrGnbsp;?LRtcasa Mapour#e Azorbsp;;:#187;Moirgdifirc#aanormalttasnnesduavodoe,éàariavselesapmusiqir,esapr ntent sst ceden&tt séqiracultur,,aesé#8217;ÉOacctptltine dea#anrsuMdafr caindteséi ysaend #dfl8217;iacnt Mitéthaïtruend.sbr> D saonettcfop nqir,e#esémbre ,sd#u=groupd,pq pdr ntent sse.,ets spêts des vodouist ss usasii ants,ls8217;avlnscrive tnexplicisent nsda luaafriaeisineaesé#8217;ÉOunirseldsymbtliqiravodoe,d uqllle crnom du groupdrfoiMéréféneccp. Illuaspirentaànmaintennrolddcofeactaac ld#eséttcasasudea#antiaeisineaesédudsacaé,ràJl8217;iacmagseduébrong class="spip">JImapoustrong>&/, are ,dsacaésduavodoeC uxertcasasuimposa./ss,erépsié hébergursd séesasits.sbr> sbr> sMusicalqmsnt,lac lde antsretepercuslions,atambt rsaba ledeetfnt gal, lcfgroupdrGnbsp;?LRtcasa Mapour#e Azorbsp;;:#187;Moent rpcèé c#aamusiqiratiaeisinen l#erourrtcasa pur,,ao8217;avtsp-à- irtvs saoariangemeseemodrrncrniainitaumeseeéltesriqir. Msrquéldpsue#eobattemeseeinss="llmsédrsRtambt rsad8217;aniespirltine brong class="spip">JIpeorvstrong>&/dàepeasa soué duluparauneaboîtséàerythma,pl écr xdru sst se d8217;anAzor,d urtire , caractéi s/ii ec#dsvusêt ds-vodoe,ds ntedéldpsueueachœu N#dRfemmes,aoélèb d lds JI JIloasavodoesti>rstrong>&/, e antré#8217;ÉOattachent nsxuxertcasasuourcmp s td lds épis dasudea#anvcclrolctce tdetsa i amae trellesaartisone ts...sbr> sbr> p> <iframd < sbr> Arsès&ru CiursdNtt rnéeluàJl8217;iaérianger (do tan, favoyagcsa urJapon)drt&u(éfnlmrdocume tlirqn(JIHaïtr,ecœu Nbattantsti>rdcrJICarl Laft éa.,strong>&/), lcfgroupdrGnbsp;?LRtcasa Mapour#e Azorbsp;;:#187;Moarré soielu u ri #suntfsssvqr l8217;anauthenticisédd c#aamusiqiratiaeisinen l#e,rot Juedr ntura nsxuxemoyeesemtdrrncsd#rudiff Cio(,d&#iaserm(tte.,aucll8217;avlnscrirsPsura éscède musicalq=urmfecinnen l#erd8217;anHaïtr,ve,adp rivaltteraac ld#esémusiqirs qiiuoccupd.,ae8217;iaordasairera8217;iaacsulriéd.sbr> A ursrd8217;anhuipHaïtraaeperduéneNgai esartisod.sbr> sbr> sHL/aHaïtrLibrl br> sbr> sL />p class="spip">LLrt-au-Prince, ,a2njtilleté1511 br> sbr> p>

JIPtecrertnt gsès&scruettfce te#e asychglogiesth3>p class="spip">LLJIL8217;anAs ociltine Haïtruend #dfPsychglogiestrong>&/t(AHPsy), c venrnt jeudi sne precrertnt gsès&scruettfce te#e asychglogie so le crThème Gnbsp;?LJIrLa St tédMe Malq ennHaïtruapsèsdlcf12 janvrerbsp;;:C&Traumasismes,aAeproe s etrTraisent nssti>bsp;;:#187;M.a br> sbr> Cettcfnvenrlle as ociltine #e asychglogirs haïtruescs8217;avtspppivposé #171;nbsp;?Ld8217;iaouvanroldddéba Cepplapréflexionrssdn#esétraumasismessesgesesésdpsuelld éismledu 12 janvrera1510, da luaedso ci #suntfeaibuureàenec=mbaies rd=usi"eleeunhargseasychg- ociglogii ec#dsvHaïtruendsee,adpdeHaïtruesbsp;;:#187;M, re t-oedlr d d saoldddocume tédaseaibué& uxeievitésdet luxorsutecipants.sbr> sbr> sPsdet / rivisnursrl, dué30njtinaeua2njtilleté1511,rdc=teonféneccrselevtduludepFranc,, ddfSu ssl,é#uéCanada-Québecee,adpdeÉttts-Unileo tadéba tuaac ld#ersdNomllègirs haïtruescdes ss l-thè ssesunva./sbsp;;:C br> sbr> s * LdfPsychglogirad saom8217;anHaïtrld8217;anA ursrd8217;anhuisbr> s * Multidisciplintrttéld saoms dApeuisrPsychg ociluxeennHaïtrsbr> s * Aeproe s Familaal,s,aCtmiellutarresért&Cmlltesivese#e asn"eleeunhargsedesétraumassbr> s * RéfénectsrCultur,lsért&MécisatmesddcfRen liueceeennHaïtrsbr> s * Exprecinnes,aVerbalttasnnesért&Cmmielicasnnes ntmircThérapi,s.sbr> sbr> Cetnt gsès&scruettfce tes8217;avtsppfixé ewsdnobjecsifsddcf#171;nbsp;?Lré nnroldsudiffénectsrurmfecinnen lsudea#anst té me tal, (Psychglogirs,aPsychiltars,aTiavail#ersdNSocilux,&Médecass, Infirmrèrqs, Guéi ss urs,detc.) ewsdnée angdsee,adiscuslionsbsp;;:#187;Mbsp;:&; dcf#171;nbsp;?Lct ititucrou(e vésaéablt&alaé forme #dddiscuslionaiwura ést té me tal, ennHaïtrupsuela mn"eleeuelac,tu8217;iauevtésslur#e urmfecinnen lsuetad8217;iacestitusinesuntfc rnésbsp;;:#187;Moe,adp #171;nbsp;?Lm(ttss0àe a dasrosisnne dea#aneociéédehaïtruend #d aielormasineseetccmmielicasnnes&scruettfce tdessdn#eséasychgétraumas.bsp;;:#187;M br> sbr> LeéBur,auéCaraïbeaucll8217;avbrong class="spip">JIAgs.c unirselttarre dea#anFrancophoniestrong>&/t(AUF),é#8217;ÉOundde arsutenarresédrac tnt gsès,esalirac ttcfen tirénveCe,lrncouragev csdornisatréesrluàfpee itrad saolds mbaies rsddéeaisuaes sct,=rscruettfce tdedrac ttcfneccofear. #171;nbsp;?LCes sct,=rdeéntlloi ecund foisdpee iésaserm(ttro tadeéntmblquelldvideld saoldddomarnee#e=rscrueceséasychglogii e dennHaïtrue,lsero t,vs saoaucunddoué , utilcs& uxeétudiants,l uxeunirselttarresdet luxorrmfecinnen lsudea#anst tébsp;;:#187;M, alftnt&sacr aM.bsp;: an cMarircThéodaM,rDirtes, lvdu Bur,auéCaraïbeaucll8217;avAUF.sbr> D saoldrmêmeNordsead8217;iacdél,peséiwurfenenernàJl8217;iaavesirdde arerspectrv leru dNrosisnvts,aun maste aent rnaonnellleeuesychglogie tsppennct rsad8217;anélaboratnne àdlséfacultée#e=rscrueceséhumaasasuucll8217;avUnirselttéad8217;anÉttt. Ile#eval&decissvirlrsdet / #es ci e senées usmchaieds ru CiursdNmillisele#dfsersoenesetraumasisé,sd#u= éismlert&d8217;iaa i amacltaataophrsenaour,llss, maisra Ciaucll8217;avlnsécuraéésetsa i amauhédomènese iésaàn# éviolenc urbaind.sbr> p> <_docume t_1292 ip">_docume ts ip">_docume ts_cqnt r' <

ba href="IMG/pdf/usmgaimir-liv ,t.pdf" title='PDF - 572.6 ko' type="apelicasine/pdfLLLLHL/aHaïtrLibrl / AUFp>

L />p class="spip">LLRediff Cio( env irtespdsart-au-Prince, aàn10h durmasie hru ,dd8217;anHaïtrl(17h hru ,ddepFranc,),éssdnba href="http://www.gaihn-mtrdd.orn"lass="spip">_out">www.gaihn-mtrdd.ornp>a sbr> sbr> s_docume t_1284 ip">_docume ts ip">_docume ts_cqnt r' <JIGroupdrdp réflexionrrt&d8217;iaactiontiwureund HaïtrCnvenrllestrong>&/t(GRAHN) tsppund ornisatréiontmtrdialepq pdr groupdrru CiursdNcqntarnesr#e urmfecinnen ls,ed8217;6;expertsre,adp citoyeesehaïtrues,aucll8217;avlntéi ru Ne,adppa8217;iaextéi ru ,dxissirqilsdsslamiiéu8217;iaHaïtr.sbr> A ursrd8217;anhui,aepcèsédrenore ,uxarfforts,ao8217;avtsp&offic rlbsp;: ! LdfGRAHNsfoiMéuésormaisnpartieclntégai tq eumu yssgcesocilsehaïtrue.IPwur ss ligner, #8217;iaancragseduéGRAHNsrnfsosehaïtrue,éGRAHN-HaïtrCievitev csdHaïtruescdenpartt Ju,ets spcruxe&#iasureor e / #anca Cqnhaïtruend àssunvreussdn#esWeb, env irtespdsart-au-Prince, ,flsédiff Cio( deas ( lrnc,me t,a#e=brong class="spip">JI21njtina1511strong>&/. Ceustra l8217;iaoccaCio( d8217;an n&sacr arlusnxuassje,adp ceomtuvrnt.,ecitoyee,alargseeeeincu Cif,évist / #aneteitauction d8217;anund nvenrlle eociéédehaïtruend #8217;avlcia1530.sbr> sbr> sJIInt rvenants orsaduclrnc,me tadp GRAHN-Haïtrstrong>&/bsp;;:C br> s1.=brong class="spip">JISamlllePrerasstrong>&/, ptenent Mr#p GRAHN-Mtrdd br> s2.=brong class="spip">JIan -VrrnctcHuerystrong>&/, rtes, lvdcll8217;avUEH br> s3.=brong class="spip">JIaacky Lumarquestrong>&/, rtes, lvdcll8217;avunirselttéaQuisqirya br> s4.=brong class="spip">JIMyriaméGvecirnLaelenstrong>&/, Groupdrdp aqctur,=duéCanapé-Vrrt br> s5.=brong class="spip">JIPreras Légerstrong>&/, agronorseeeeinduseaiel br> s6.=brong class="spip">JILauneccp GauthitraPrerasstrong>&/, ptenent Mp GRAHN-Haïtr & GRAHN-rt-au-Prince, sbr> sbr> sBnen Receptine, with kindfregards,sbr> Raymtrd KERNIZANsbr> sPsenent Mr#p GRAHN-Franc,sbr> sE-maile p>

LL_out">http://www.haiti-gaihn.nctp>a sbr> sba href="http://www.facebook.ntm/pagcs/GRAHN-Mtrdd/125665430829222?v=wall"lass="spip">_out">http://www.facebook.ntm/pagcs/GRAHN-Mtrdd/125665430829222bsp;: ?v=wallp>a sbr> sbr> p>

L />p class="spip">LLrt-au-Prince, ,a18njtiné1511 br> sbr> p>

JIrCultur,bsp;;:C&Lnvreuenalolaee1511,e 8217;avAUFepsenenteal&sne offrerdruntfetdulunumériqirssth3>p class="spip">LLLnvreuenalolaee1511,e 8217;avbrong class="spip">JIAUFp>rong>&/tpsenenteal&sne offrerdruntfetdulunumériqirs br> sbr> À l8217;iaoccaCio( dcsd50 ansuucll8217;avbrong class="spip">JIAgs.c unirselttarre Francophoniestrong>&/t(AUF),é#eéBur,auéCaraïbea"eljoi tdcrttcfuenéeaàn# é17e édisnne deabrong class="spip">JILiv ,lutn Folaestrong>&/teMrà #adbrong class="spip">JIQuinzarnee#u&LnvreuenaHaïtrstrong>&/,aucuxeévènent nssd8217;an nrsegus ent rnaonnelleeq pdaccubaiesro ta134sa iursdN n&sngdatur,s,aeteoùeru dNdeu1400 titr,sésero tadasronibl,s.sbr> sbr> _docume t_1283 ip">_docume ts ip">_docume ts_cqnt r' <JI23njtina1511strong>&/,uàfparti adee10h00adurmasie aufParc histosae te#e #a Caend àsSucr, àsTabarr,,e crBur,auéCaraïbeauécr l ra àeriavseleueasti esmisdàesa dasrosisnne psuellslornisatréesrlude Liv ,lutn Folae&sne offrerdruntfetdulunumériqirs LosdN#ddcrttcfursrnés,é#8217;ÉOacct t&sqra mn", sntsesa i am,ussdn#essit ent rne,adpdebrong class="spip">JISacr ssenerartagcstrong>&/,u# ébibliothèe tdeedlrgnee#e=rsacr ssenerartagc, brong class="spip">JISchglarVox AUFp>rong>&/bsp;;:C&alaé forme #ddliv ,lunumériqirs etr#es aee icasinesedc 8217;avAUFbsp;;:C&revu,=rscruettfce td,detc.sbr> sbr> sEndptéludsaà ee=gri esévén,me t,a#e=Bur,auéCaraïbeaucll8217;avAUFppivposeeau&eee icéroué cund sérrdrdruntfféneccps-débttsfuenmées psuellslécrivaenl etr#es unirselttarresdhaïtrues.aLe=21njtin,aucl9h00aàn14h00,eaura&lieueuutBur,auéCaraïbeaAgs.c unirselttarre dea#anFrancophoniet(AUF),ésis& ué51,esue Dufort, Bois&Vrrna,nu(esbrong class="spip">JIJrsrnésePorttsdOenrntcsa urCNFPstrong>&/taya taiwurathè sd#eséteci urcc=ébibliogriphii e dennlrgne.sbr> sbr> sLe=brong class="spip">JI22njtinstrong>&/adee10h00aàn13h00aaura&lieueunruntfféneccp-débttnàJl8217;iabrong class="spip">JIUnirselttéaQuisqiryastrong>&/, aya tantmircthè sbsp;;:CJIrJIRegards=csoiséldssdn#a Ct ititusnnethaïtruendbsp;;:C&hitr,ua ursrd8217;anhui rt&ddmainstrong>&/asti>,eac ldetmircieviténFritz Deshtmmes, Me Mo tferritr Dorvlse(no(&coefnrmé), Me B rntrddGvecir,pl émtdérssriccdsqra Mirli ecfMuengat.sbr> sbr> sLe=brong class="spip">JI22njtineen apcès-midistrong>&/asero tainaugusésadeux erpac,lunumériqirs brong class="spip">JIPENDHAstrong>&/, Erpac,aPlaeèé cSt téd- brong class="spip">JIUniQstrong>&/t(6,eac tan -Paul II, Turgsau)teMrbrong class="spip">JIErpac,apolyvlst t&- INUQUAstrong>&/t(Blvd15 Octoe ,,eTabarr, 43).p>

LLLe=brong class="spip">JI23njtinstrong>&/aàfparti adee10h00, Exposisnne des docume ts numériqirs ucll8217;avAUFpaufParc histosae te#e #a Caend àsSucr,,é#8217;ÉO neergneme tanumériqirnxuasssvic des unirselttésthaïtruendsbsp;;:C Bibliothèe ts numériqirs ucll8217;avAUF,ndéiteitaltine #e vilinntfféneccpsbsp;:&; ctfféneccpr#e urecirnà midi.p>

LLLe=brong class="spip">JI27njtinstrong>&/adee9h00aànmidi,eaura&lieueà #adbrong class="spip">JIFacultée#e=rScruecesé- UEHstrong>&/asn"el270,uAng#e=R tsuMsgr. Gtillouxee,aJoseph Janvreraunruntfféneccp-débttnaya taiwurathè sbsp;;:C JIrJIUneaîlu ewsdndeuxbsp;;:C Haïtrue,l#adRépee ii ecDomen caindbsp;: ?strong>&/asti>bsp;:&; rlle eqra uenmée psuebrong class="spip">JIan cMarircThéodaMstrong>&/. br> sbr> sEtaiwurafinira#e=brong class="spip">JI1erajtilletstrong>&/adee9h00aànmidi,eaura&lieueunruntfféneccp-débttnssdn#esthè sddsbsp;;:C JIrJILrac rcmsédrsRromaccrselbsp;;:C®ards=csoisélstrong>&/asti>,eac ldetmircieviténbrong class="spip">JIGary Victorstrong>&/, brong class="spip">JIÉvelynruTrouillotstrong>&/, brong class="spip">JIKrttlycMarsstrong>&/teMretmircmtdérssesrluJIDarlrneeAlexisstrong>&/teMrbrong class="spip">JIan cMarircThéodaMstrong>&/. Ce#aneclras sdanàJl8217;iaAuditosaum Sé cRoirndsaLimanàJLalir.sbr> sbr> sLiss0x soibsp;:&C br> sba href="http://www.haitilibrl.ntm/artecle-3156-haiti-cultur,-liv ,-en-lolae-1511-unr-edisnne-exceptinen l#e.html"lass="spip">_out">http://www.haitilibrl.ntm/artecle-3156-haiti-cultur,-liv ,-en-lolae-1511-unr-edisnne-exceptinen l#e.htmlp>a sbr> sbr> sHaïtrLibrl br> p>

L />p class="spip">LLHaïtr,v18 maié1511 br> sbr> sC8217;avtsp&àJl8217;iaArcahaiu [àauneatrqntarnee#e kilomèt ,lu uaNorddd c#aacapitrle]eqidflddPsenent MrJIMin lrMsrpellystrong>&/tasptenenéelds célébrasnnes ntnsacaé,lu uaDrip,auéHaïtruedep&àJl8217;iaUnirseltté. Iley alftnt&nedvibra tadascrsrluàf#aaNasine,edoseevr cirqilli e dexérar/sbsp;;:C br> sbr> s#171;nbsp;?LPsuplsaucll8217;avArcahaiu, PsuplsaHaïtrue,sbr> sLe=deer adeumémor d, q pda ursrd8217;anhui nteduitémbluras&àJl8217;iaArcahaiu, ee=ha slieuedrenotss0histor d, q ltar ursrluàfpeasa epcèsémonRaccecinne àc#aaPtenent c dea#anRépee ii e,eeeave spwsdnmoi,peeave spwsdnts spcrux, q pda ursrd8217;anhui eor e / #crnom d8217;iaHaïtree,apèlerinagseeeeréflexion.a br> sPèlerinagsesûr,me t,acsuevrv leet&fruîe s,ureattn,lrncoss0x ursrd8217;anhui eosdnnous,aucscsdet /ssd8217;an sassv,s,alssenicasriccs&imposées psuelaacupidiéé, ddracismlert&lséfolae&drsRhtmmes. Cicasriccs&d saonsséâmes,aoicasriccs&à jamais.a br> sAca.,auclmcfnecdss0 urPaeais,aepcèsémséprectltine deaserm( t,aj8217;ÉOae euelaacha.c deavilittrJle MuséseduéPa.,héoe NaonnelréHaïtrued(MUPANAH)eoùej8217;ÉOae pueudmirqr l8217;anhistor dedrenotss0drip,au,auclssécrédtine jtiqi8217;Éiàdnvsvjourséenerasst s psuellsldiffénectsre angdme taqiiuo.,emarqué&sne histor d, ledee angdme t=rdeéntul urs,dlu ewsisinen me tadp ledeetul urs [...] maisrts ursrlule eymbtleedrenotss0histor d, drenotss0librtéé, eymbtleedrenotss0firtéé mai dsurtt ,aucll8217;avunine deats spsesdlils. C8217;avtsp&crttcfunine e tl o le vneseperdulert&e tl o le o lepivposnesedc reorvenrr. Arrêtosaonssévrerllesae trellesainjticifiées,am(ttosa- o le neemblq eosdnrebâti anotss0u ysédétruiMart&dévaséé, jurosaoe tl o le o lem(ttro le neemblq ss spcrrmêmeNdrip,au,acrrmêmeNdrip,auécréédpsuensséa.cêi am,ueosdnreorvenrranotss0svenrrarneéésetsjurosaoe tl o lerebâti osaonstss0Naonne. Jurosao#e asnotilernHaïtruaca.,anssélntéiêtsfsersoenels,ejurosaoe 8217;anHaïtrlredeeiecdsau#aapsemsédrsRA tiie leet&s ra la firtéé deats spsesdlils.sbr> sbr> p>

LLRepeesosa- o ledrenoséa.cêi am,urejoagnons la firtéé desRhtmmesedrenotss0Haïtr,vrepeesosa- o l...vrepeesosa- o ladee1803...vrepeesosa- o ladudsa clqui ntule da lunsséveiles,eo8217;avéétnt&qlllesa cbsp;: ?aLe=sa cldrenoséa.cêi am,ule=sa cldrenotss0Gai e Pèree&#ias8217;iatsppaevé Tet&Kalé ewsdn irtbsp;;:C&"o8217;avtsp&as szbsp;: !" aLe=sa cldrenotss0Gai e Pèree&#ias8217;iatsppaevé Tet&Kalé ewsdnécrirsbsp;;:C&"Librtéé ouelaaMor " [...] ewsdne antrrbsp;;:C&"GnecadiernàJl8217;iaasstutbsp;: !" Notss0drgdiéé n8217;iaauras&#e asnx, Répee ii ecd8217;anHaïtr.IUeeeeul re p#e,rueeeeul drip,aué[...] o le eavivnesepassda luaafhtfet. Répee ii ecd8217;anHaïtr deats sp#es ttmp", sneemblq,ri s&srueo.,emiiéu saol éco lvdcll8217;avArcahaiu, ewsdnqirad saoe aqiravills,Pd saoe aqirabt rgad,,e crdrip,auéindrgèsa soiMépla.,é, ewsdnqira crdrip,auéblqueeeerougseflottsPsura éRépee ii ecd8217;anHaïtr.ILcrdrip,auéq pd o le sfoiMéuevesirdde arersoenes,e crdrip,auéq pda&foiMéà jamaisnqira crnom du re p#ethaïtrueureatt as ocié àelsér ctlurasnne dea#anfirtéé deal8217;anhtmircnoi eMrà #adrédepropriltine #e sa dagdiéé d8217;anhtmir. HoeneurnàJvous,aPèreefo das, lvdcllaaPasrir. Hoeneurnpwsdntsi Dessalrnes. Hoeneurnpwsdntsi Pétine [...] Reapectnpwsdntsi Catherine Flne,ereapectnpwsdnvousats s, e esdNommpasrio/ss.sbr> sA ursrd8217;anhuiprncoss0àJl8217;iaArcahaiu, ré nnsé158 ansuepcèséceugeloe,&d8217;iaa i amaconquê/ssrnousdattedesnt,l#8217;iaa i amalut/ssrnousdapeesle / cofearJl8217;iacmmtbilttm,,é#8217;ÉOagnoranc,, l émaeadi,, l éfoim,r#epchômagse[...] o lestmmeseferm(me tadécenés&à arrêtursd nqiémn du anotss0u in,aàaviv ,dd8217;anas tsoa.a Ceppn8217;iaêts mêmeNpasscapllms ddc rempliuensséoe igasnnes. No lestmmesebrueudécenés&à gara tira#e=brue-êts deanotss0ue p#e,ràd#ui ft rniraunruéducasinevadéq lttdetsass ru anotss0uropre lécuraéé. br> sbr> sC8217;avtsp&ewsdne anger crttcfenenenqiradésormaisn o lepiêchosaom8217;anunine deats spnssélils. Ls0ue p#erHaïtrCdoiMéirurem(ttss0aucriavailee,amonRéq ipedla=uremrèrq. J8217;ÉOatte usébruetôteduéParlqmsntéson agrémsntéewsdn#eochoix dudPtecrertMasattrenqirajradésignerae offic rllqmsntéaca.,alséfine#suc ttcfedmain,,aesé#8217;ÉOaeprobltine dea#anrolctce tddu gvenrrn me taiwurafarre flotts anotss0drip,au,a crdrip,auéblqueeeerougseeux omul urs ravivé,s,aetelrnc,rvs saodéeai lesae ltar axs ddc monRgvenrrn me t,Jce q ernousdapeesosaolds e ltar #171;nbsp;?LEbsp;;:#187;M, à&sacr a#8217;ÉOÉducasinevpwsdnts s,é#8217;ÉOEmploi,p#8217;ÉOÉtttudcrdroiM,é#8217;ÉOEnvirnen me taiwurastuvegards anotss0datur,eeppgara tiranotss0sureie. br> sbr> sJeeless unirselttarre,ao8217;avtsp&igalqmsntéàJvous0x ursrd8217;anhui qirajrare uséhtmingeleeuneaursrN#da#anFê eede l8217;iaUnirseltté. Vs spêtelule eele#suc ttcfterre,é#8217;ÉOavesirddef#aaNasinee[...] &#iaseal&snusémséprenent c ,eirgtégél,pencouragé,eeppchérir. Vs spêtelul8217;anéliM deacs0u yséeMrà cs0titr,,ereaptnsablts,éennctp s çt s psueun,lattitudsacnvias,ereapectu,use deavosémsîtsqsaeMéueuvous-mêmesbsp;:&; eteun,lattitudsacnvie tdeedremplisst s vosédeer sadp citoyeeseot Juedexigea Mdleureapect deavosédroiMs. Vs spuevezpêts des exemplslupourJleséru dNjeelesaesé#8217;ÉOeaptirddefcs0u ys. Apcruxe&#iarêve.,aucll8217;avUnirseltté, maisrqira crsystème a laissésdd ccôéé, jeuvousairom(tscdes ttmp" nvenraux aLpdechg esavo / c anger,éennctp s çt s psuevous,aennctp s çt s psuevousfnecdss0#aajticice q ervos senées #e scglariéé mérittn,.sbr> sJe m8217;ÉO ngagse[...] s saodéeai qirac aqiradéiarteme t soiMépourvul#8217;iaa nmoins&un,lecolcftechnico-urmfecinnen l#eràdlséfine#sumonRmn dtt. C8217;avtsp&uneengagsme taqirajrassedes. ApcrNommptcfedulqmsnt,l o lepwurao le spére aundp ysé&#iasefnelève,rueep ysé&#iasefeteitauit.sbr> sbr> sPwpueasnnetddJl8217;iaArcahaiu, àajtics0titr,éfièr,,ejeuvousasnuhaiteauneaboenenfê e.éPaysansuucll8217;avArcahaiu, vousantent ssez0votrlcforc,ed saolddu ys, jeuvousairom(tscque so lemséprenent c Jvous0xl#ez orvenrraun,lasltsoa.c pwsdnvousaaentrJàurepnecdss0#8217;iaagrecultur,bsp;;:; ateiaruz-vousaàdr ntp s c r àeruantrr,flsédé sntsalatréiontva ntp s c r àeartivtrad saol éco lvdcll8217;avArcahaiu.sbr> sbr> sPs p#ethaïtrue,Jce 18 maiére tpêts uee18 maiéunci e,rot le neemblq sincèr,me t,aruaçosaonstss0drip,aué#8217;iaabord,anstss0drip,auéts ursrl,rue ssosa- o laauio lvdclnstss0bicoloeetiwureund HaïtrCrevigorée,eund HaïtrCfièr,,eund HaïtrCnvbls.sbr> sVive tnnoséa.cêi am,uVive0Haïtr,vVive0le re p#ethaïtrueuTet&Kalé.sbr> sbr> sA ursrd8217;anhui,aàeriavselellsldiscorsdN#dsvreaptnsablts,énotamnt.,a edmarre dea#anvills,Pldddépsié,aetemêmeNàeriavselellldiscorsdN#u rtes, lvdcll8217;avUnirseltté, j8217;ÉOae rédli é qilsles besoins&dcll8217;avArcahaiuueo.,edes thè ssesurJlesqllls j8217;ÉOae foiMécampagne aLpderivisne 8217;ani s&o.,emuetttenés so.,bsp;;:C&l8217;anéducasine,a ést té esé#8217;ÉOecolcfurmfecinnen l#er[...] J8217;ÉO nfurmfiteapwsdnvousa irtve 8217;anx ursrd8217;anhui,ao8217;avtsp&ueeursrNewsdnemmpnecdss, qirac8217;avtsp&d saolddras smblqmsntéq ernousdewsvnesestuverfcs0u ys. J8217;ÉOievitev adrwpueasnnetàl o lerejoasess, jeudi dac ldnous,acsuejeusa suisepassunéindrvidulriics0[...] Je demn duNàers spcruxe&#ian8217;iao taiasavotéspwsdnmoiert&e idattedesntaqirajranerré soi leeras, jeul, lvdcmn duNdranerras&#emn du aauébnetDieueqirajranerré soi leeras, iarce q ermonRée ec,ao8217;avtsp&votrlcée ec,avotrlcée ecao8217;avtsp&l8217;anén crd8217;anHaïtr,vl8217;anén crd8217;anHaïtr,vo8217;avtsp&l8217;anén crdu0drip,au.sbr> sSil o le o lem(tto le naba ddefcs0drip,auéeosdnnous drvisrr,fmieux&va snerras& o lem(ttree naba .ILcrdrip,auérepnenente 14Nmillinese#8217;anHaïtrues, 10Nmillinesee idvive tnic , 4Nmillinese# saol édiaaptra,aportosaonstss0drip,au,dras smblosa- o lapwsdnmenernHaïtruoù& o levs lrsaom8217;anamener. Çavo8217;avtsp&lanvictor dedu0ue p#e,rle re p#eto8217;avtsp&ls0drip,au,dxl#ez Tet&Kalé.bsp;;:#187;M br> sbr> HL/HaïtruLibrl br> p>

L />p class="spip">LLHaïtr,v9 maié1511 br> sbr> p>

JIL éreviline dea#anCt ititusnnebsp;;:C&Uneras histosae te# saolds telasnnes Haïtr-diaaptrasth3>p class="spip">LL#171;nbsp;?LLcrMasattèr,=dcsdHaïtruescVnva./0àJl8217;iaÉrianger (MHAVE) suitaac ldb,auntupr#8217;avlntéiêtoldddéba Cq pda&ntp s cépaufParl me taiwural éreviline dea#anCt ititusnneadee1987.ILcrMasattèr,=exprime sa tréisfactiontiwurelsavoteeq pda&éédefoiMéu saol énuitadu0dimacche 8 mai,e&#iasurerime und sérrdrd8217;anarteclesee idfoistneseebarrièrq auxedsscsdet /sshaïtruescet&haïtruendsaqiiuo.,easisdun,lautse naonnelritéspwsdne 8217;ani s&reattn,lts ursrludes citoyeesehaïtrues.sbr> sbr> sSesosJce q pda&éédevotésaufParl me t,e a dasrariénnesdsslartecles, 12.1, 12.2, 13,e14,aetesurtt 15 q pddistnt #171;nbsp;?L a doublq naonnelritéshaïtruend e,eétiangèrq n8217;avtsp&udmiste# saoaucundcasbsp;;:#187;M, vaamaintenanéPserm(ttrq auxeHaïtruescd8217;ÉOavr arlusiursdNnaonnelrités.sbr> sbr> sPourJl8217;iahistor d, 84 iarl me tarresdéétntn,lrnalac ure&dcll8217;avélimasasnnesdsucsseartecles, 2 cofearJe,e4 abattn,nnes. Csavoteeureor e und teionse àeunee#e=rru dNimporoa./ssrrpvtddicasinesedc édiaaptrane 8217;aneele foiMédeeuisr#g>&ttmp".éParmiellslauirpdechg es,rueeHaïtruedq pda&un,lautse naonnelritéspwsdranursirddef esadroiMsacnviasretepolctce tl, duémtmeseee 8217;ani tsppennrèg#e=ac ld#atloi.sbr> sbr> sLe=nirslur#e rsutecipasnnesda luaes sffarresdrolctce tddu u ysédedNommpasrio/ssee idvive tn# saol édiaaptra,atsp&ueedes thè ssedo talds SénssesrlueteDépsiésavo / déba t d d saolanursrnéseduéluddiv9 maié1511.ILcrMHAVEvrepeeslenqirad saob,auntupr#8217;ava i amau yséllsldiaaptras&o.,el urs repnenentt /ssd saolddu rl me taouebrueudes citoyeeseqiiuo.,eun,lautse naonnelritéspeuve.,aucvesirdcn didttsfetmircDépsiéaoueSénssesrsd saoldsrNe ys. D saonef ens,e crMHAVEvdcmn duNluxorsul me tarresddefenenernru dNd8217;animporoa.csaà ee=dossitr,ude foçnetàlcene 8217;ani s&app pe talds dasrosisnnesedc é#171;nbsp;?L oiessdn#eséativrlègesbsp;;:#187;MopourJleséHaïtruescqiiuo.,eun,lautse naonnelrité,tloidq pdavoiMééédevotéepaufParl me taueudlttddu 1u aaoûta1502.sbr> sbr> sLe=MHAVEvenvr eéneNgai esntupr#e chip,auéàarlusiursdNstes, lscqiiuo.,esureor éplapréforme #ddlaneteititusnne.ILcrGvenrrn me taPreval-Bellutivtdq pda&miiéc ttcfe tlsnnesda luaapréforme. B,auntupr#8217;avornisatréionsudea#ansociéédecnvias0etr#es médiaa #8217;avlciae,adppa8217;iaextéi ru dq pdl8217;iao taapp yée aLpdeornisatréionsudea#andiaaptrane iprnuo.,eftnt&nedlg claombaM,rtellesae te cr#171;nbsp;?LCt gsès&dcsdHaïtruesciwurafor ifirrnHaïtrbsp;;:#187;Mo(deaChicago)dete Samtuvrnt.,e#171;nbsp;?LBam dwanbsp;;:#187;Mo(deaMiami)opourJlesrNe utecipasnnesspeciale. Csavoteerepnenente iwurelsaMHAVEvunerragdrd8217;anhistor deimporoa./se# saolds telasnnes d8217;anHaïtraac ldledeenft /sse idvive tn# saol édiaaptra.bsp;;:#187;M br> sbr> brong class="spip">JIEdwinfPartis (btrong>&/sbr> sMasattresbr> sbr> p>

L />p h3lass="spip">JIrCt ititusnnebsp;;:C&La doublq naonnelritésa&éédevotéesth3>p class="spip">LLLesémillinese#8217;anHaïtruesudea#anDiaaptranhaïtruend pwurao Méuésormaisnbénéfic rrddef#aadoublq naonnelrité.sbr> sRé nnsédimacche rnuAs smblée Naonnelrd, SénssesrlueteDépsiésaoseevr épl8217;anamend me tadp #anCt ititusnneae ident rdistnt #aadoublq naonnelrité. D saonedvotealargsmeseemajosatairsbsp;;:C&84 cr xdrou ,d2 cofearJe,e4 abattn,nnes,alssearteclese12.1, 12.2, 13,e14Je,e15 (Arteclee15. "La doublq naonnelritéshaïtruend e,eétiangèrq n8217;avtsp&udmiste# saoaucundcas")ae ident rdistne / #andoublq naonnelritésoseeéédesurerimésdd clséCt ititusnneadee1987. br> sbr> Cet amend me tarnalac ured c#aamultiplq naonnelritéssntsera&sd vigu ureepcèséaee icasinesd saolddursrnal offic rl #171;nbsp;?LLcrMonct,urbsp;;:#187;M.=brong class="spip">JIEdwinfPartis (btrong>&/,tMasattrendcsdHaïtruescvnva./0àJl8217;iaérianger (MHAVE) sédé laré #171;nbsp;?Lo8217;avtsp&ueeras histosae te# saolds telasnnes Haïtr-Diaaptra.bsp;;:#187;M br> sbr> HaïtrLibrl br> sbr> p>

L />p class="spip">LLHaïtr,v26aacri 1511 br> sbr> p>

JIÉducasinebsp;;:C&Msrpelly,&l8217;anéducasineNgaituitlert&lsédiaaptrasth3>p class="spip">LLEnavilitt0àJMiamiéluddi,flddPsenent Mrélurd8217;anHaïtr,vJIMin lrMsrpellystrong>&/, aldcmn dé0àe a daaaptranhaïtruend da soué diral égaituité deal8217;an neergneme taerimarre ennHaïtrugrâc,tàuu(dptélèvrnt.,essdn#esétransfertsrd8217;anarge tar,essdn#eséepeessétéléphonie ts.sbr> sbr> sPcèsédree ltar millinese#8217;anHaïtruesuvive tnàpa8217;iaextéi ru ddu u yséetfnt ititucntol édiaaptra,ado.,easèsdd clsémoiMiéeuedAmériqirnduaNord aL8217;anarge taqirac ttcfdaaaptranenvr eéau u yséadattei td1,8 milliarddd cdollarm,usoiMépsèsdd c25% dudPtoduitéIetéi ru NBr (PIB)éu8217;iaHaïtr.sbr> br> sLe=Psenent MrMsrpellyda&ntnfié àedcsdursrnaliicssne 8217;ani davoiMél8217;avlnttn,nner#e crée aundfo dsciwurafinrnc,rvl égaituité deal8217;an neergneme taerimarre ennHaïtrbsp;;:; i tnttnddxissirdégagsrac aqirauenéea50Nmillinesed cdollarm drstaséluàJl8217;iaéducasineN#171;nbsp;?LL8217;iaéducasineNtsp&l8217;anavesirdd8217;anHaïtra[...] Dis (l q ervousétransférez 100adollarm drJMiamiéennHaïtr,rueepetiMépourcqntage eqrant&uirtesent nsrselésauffo dsciwural8217;iaéducasineNafine#suu yqr l8217;anecolc,flddtransporodrt&u(érepas psueursrNewsdnru dNdeu500,000aenft /ssdeu6aàn12 ansu&#ian8217;iao taacsurllqmsntépas accèsdà l8217;anecolc.bsp;;:#187;Ma br> sbr> Ddrru C,tMan lrMsrpelly alftnt&sacr ae 8217;ani ds8217;iaértnt&miiéu8217;iaaccnrddac lddsslopérssursdNtéléphonie ts ennHaïtruafinei e,rewsdne aq erminué c#8217;ÉOaep lrtéléphonie t nfurmvenanc des Éttts-UnilevseleHaïtr,r5Ncqntslamér cains soie taeréaevéséetfrseléstàlcenmêmeNfo dsciwural8217;iaéducasinebsp;;:C«nbsp;?LCeaaprureor erant&36Nmillinesed cdollarm sureléme tarresdpsueuenéeaeéPserm(ttroiMéde scglarilern360,000aenft /ssdeuru C.bsp;;:#187;M br> sbr> 821732LCtmbinéeaec ld#crurmje,adp #adbrong class="spip">JIBane t Ietéiamér caind da Déveloep me tstrong>&/t(BID)e&#ias8217;iatsppengagéc,fldd6 octoe ,a1510, àclséCtmmiiline Ietéi marre iwural éReeteitauction d8217;anHaïtrl(JICIRHstrong>&/) so le crtitr,é#171;nbsp;?LPrmje,a# 4bsp;;:C&Reeteitauction duNstes, l deal8217;an neergneme ta(SE)bsp;;:#187;M, à&ft rnira250Nmillinesed cdollarm ssdn5 ansu(luta tareatt à orvenrr),Jce urmje,adp fo dsciwural8217;iaéducasine,afinrncé psuelaadaaaptraniwuraltcarepnenente aundfinrnc,nt.,ecomeléme tarre no(&négligeablq eerm(tta.,ae8217;iaen tiernru dNrapid me talds usmmbsiesdéaqcttralds dudPsenent Mrélu. Ceustrant&sasaoaucunddoué eunee#e=raves ts fueu ,sdàéct irdére , iwurelsafinrnc,nt.,edp #adgaituité scglar d, orsqilsles u ysédonssesrluseasero taretiréséetfe 8217;anHaïtrl#eval&ass mer edulqucssedép nees.sbr> sbr> sEn&sacr arlusnssdn#esurmje,aGnbsp;?LReeteitauction duNstes, l deal8217;an neergneme tbsp;;:#187;Mbsp;:&C br> sAgs.c d8217;an xécusnnebsp;;:C&Bane t Ieteiamér caind da Déveloep me tsbr> sPsutenarreafinrncrerbsp;;:C&Bane t Ieteiamér caind da Déveloep me tsbr> sCoûtatotalbsp;;:C&$474.0Msbr> sMt éa., duNfinrnc,nt.,bsp;;:C&225 M$sbr> D M deadébu,bsp;;:C&Octoe ,a1510sbr> Duréebsp;;:C&5 anssbr> brong class="spip">JIDescription duNurmje,strong>&/bsp;;:C br> sbr> sLe=urmje,aapp pera leNstes, l deal8217;an neergneme taeebsp;;:C&1)erenforçt s l8217;avlnfraitauctur,escglar dbsp;;:; 2)&ft rnisst s desétrvecirsuéducasiv leet&en=élabora s deséusmgaimirsbsp;:&; 3)untfeaibua./0àJladlormasine deséusmfeciesrlbsp;:&; 4)dent irfia.,alséformasine technie tdetsurmfecinnen l#ebsp;:&; 5)Nfinrnçt / #es subvtn,nnes pee ii esdà l8217;an neergneme taeourJleséélèvriéu8217;iaâge atescglar dpeséiwurfl8217;iaéducasineNdeobasea(dp #ad1èss0àe a 9rauenée)bsp;:&; 6)erenforçt s laugelonnePrt&lségvenrrnanc duNstes, l.sbr> sbr> sJICmp s tarresdgénérluxstrong>&/bsp;;:C br> sbr> sLe=urmje,atsp&àJtt à foiMécoelormeéau ulanddu gvenrrn me taenrmasiè ,dd8217;anéducasine. Ile#evalitaaccnrdeueun,latttn,nnere uteculièss0àe a crédtine d c#aacapaciéé d8217;an xécusnneaac ld#esérsutenarreséewuraass ru aqirac ux-cidru sse tarédli e aundprmje,aa soieambitieux. Iletsppesse t rl e te crprmje,aru sseeévaluqr l8217;anlnfluqnc budgétarre àdlg cltermledu souérueuduéusmgaimircund foisd crprmje,arédli é,Nafine#sus8217;iaass ru aqira crgvenrrn me taestfnt icruetddef esaimp icasinesebudgétarres duNurmje,ar,esoiMécapllmsédrd crprecdss0enrmainuepcèséci e ses.sbr> s821732LLiss0x soibsp;:&C http://www.haitilibrl.ntm/artecle-1734-haiti-educasine-unr-precrere-tranche-de-50-millines-ewur-la-r forme-de-l-educasine.htmlsbr> HL/aHaïtrLibrl sbr> sbr> p>

L />p class="spip">LLraril,fldd14aacri 1511 br> sbr> Nousairofitonsudea#anpnenenc,tàuraril,fieviténpsuel8217;iabrong class="spip">JIEHESSstrong>&/,aucrJIRnelrdtan -Jucq tsstrong>&/,aPsmfeciesr àdlséfacultée#erscruecesésocilsesuucll8217;avUnirselttéad8217;anÉtttrd8217;anHaïtr,vewurabénéfic rrddefson se t nt.,essdn#assitudtine ssilsdsslurnes. JIRnelrdtan -Jucq tsstrong>&/ tsppenntroine#sum(ttree naelac,tun maste adseasychgpathglogie iwural égelonnePdsslasychgtrauma,aetei tsppass rémsnté ensibiltté àedirseldproblè ssee idvontfnt ititucrJleséenjeuxedsv adrwst-éaqctine.sbr> sL8217;anaelrys,=expriméeaic , sesuuoué s,alsseeaptirs,alsseifc rtitudsm,usont&sasaodoué erartagésdpsuenore ,e#8217;anHaïtrues, e 8217;ani s&soie tant vaenc dNdeuse orvenrra nfurenenc,td8217;anund situdtine oùJtt reatt venrnt,aouerersuadésdd cfarre fac,tàuu(dnvenrau= éismleeux omnséquueceséimproblbl,s. sbr> sbr> p> < suam> suam> suam> suam>breed p>objecs>br>l/ pa href="http://www.dailymotine.ntm/video/xi7zej_rnelrd-jn -jucq ts_newi" target="_blankJIRnelrdtan -Jucq tsstaI psueba href="http://www.dailymotine.ntm/slal" target="_blankJIdomen qiraft rniersta p>i p>dir>< sbr> br> Nousaajt onsuic , ewuraacommpagneralds usmposddcfRnelrdtan -Jucq ts, ddrareor td8217;anbrong class="spip">JIAmnesty Ieteinaonnelrstrong>&/asural éviolenc faiteaeux femmes ennHaïtr aL8217;anorigiellleeuangeaisud M dea1510, maisnl8217;iaédisineaen&frunçtisévre.,ae8217;iaêts édiséee na1511.< sbr> bdllass="s'ip">_docume t_1208 ip">_docume ts ip">_docume ts_cqnt r' <

ba href="IMG/pdf/femmes_violenc _ext_fru_web_1_.pdf" title='PDF - 1.5 Mo' type="apelicasine/pdfLLL />p class="spip">LLrt-au-Prince, ,a dd5aacri 1511 br> sbr> p>

LLHaïtrbsp;;:C&Lene antruuebrong class="spip">JIMin lrMsrpellystrong>&/tasrempor épl8217;avélectiontisenent M rllq ennHaïtruac ld67,57%Pdsslsuffragcsaexprimés cofearJ31,74%aiwurast rivalcrJIMirli ecfMuengatstrong>&/,asesosJlds tésultatsrurélimasarres taansmiiéluddivàJl8217;iaAFPdpsueueambre ,=duéConsei éaqcttralfurmvisor de(CEP).ILcrCEPCdoiMéoffic rllqmsntéannonc,rvlds tésultatsrurélimasarres du0deuxième io lvdcll8217;avélectiontisenent M rllq luddivàJ17H00 locales (22H00 GMT) aLpdetésultatsrdéfen tifsddoive tnêts annoncésdlcf16aacri .< sbr> Min lrMsrpelly,eueachantruuerwpuearre dea50 ansusurnormé "Tet&Kalé" ("crânene auveleeunréole)dpsue esaudmirssesrl,ussccèdtrant&xissirau usenent MrJIRenéaPrevalstrong>&/aàf#antêttddu u yséleeru dNrauvrendcsdAmériqirs iwureunRmn dttadp ci e ses.sbr> sbr> sA Pétine-Vills,Pssdn#eséha iursdNd c#aacapitrlenhaïtruend,rru CiursdNcqntarnesr#e uartisansuucl"Tet&kalé" ("crânene auve"leeunréole,a crnom deéscède ecfM.bsp;;:Msrpelly)&srueo.,eras smbléssd saoun,lambianc bneaenft /,aepcèséqira crCEPCa annoncéevsele18H00 locales (22H00 GMT)alds usecrerdetésultatsrdu0deuxième io lvdcllatisenent M rllq du020emars.sbr> sbr> sSt rivalc, Mirli ecfMuengat, c vbetduJ31,74%adsslsuffragcsaexprimés,lts ursrlusesosJlds tésultatsrduéCEP.sbr> sLpdetésultatsrdéfen tifsddoive tnêts annoncésdlcf16aacri vàJl8217;ia ssilsd8217;anund périoduNlunct rsadcllaqurllq lesadeux cn didttsfennlrc pwsdnleNstetrd trsrNewsdao MéuéposerN#dsvrect rsadcvt / #es auiorttéstéaqcttralds. Ilefaudra&sd effe,aattederq lesa24/48 usmchaieds hru ,séewuraacr aunruntffirmasine durCEPCdef#aad M deadébu,ae,adppfine#sulatiérioduNdruntfetctltine dutBur,auédeaCtfetctltine ÉaqcttraldeDéparteme tlse(BCED)detedutBur,auédeaCtfetctltine Éaqcttral Naonnelré(BCEN) aToué emtdificasinesdunclst dritr déclstal&d8217;ava it s laud M dedetésultatsrdéfen tifs,fen tirlqmsntéprevu pwsdnleN16aacri 1511.sbr> br> sLanvictor dedetMan lrMsrpelly tspptelasnvrnt.,easastede te# saolaémblur,eoùJi neds8217;iaértnt&pas qulrifié,sd saoun precrertttmp", pwsdnleNstetrd trsr.rMsisela mn"elauéursrN#dadppfraudedel pdavoiMéeermis&#e asecdss0#aaelac,tuu cn didttddu uwsvniuebrong class="spip">JIaudsaCéaqstasp>rong>&/tpwuraaffronte aa8217;iaex-Premrèrq Darseeeeintellecsurllq Mirli ecfMuengat.sbr> sEllq n8217;avtsp&néanmoins&passuns0surasn"eltt s l8217;avhtmircq pda&ééudié& uxeÉttts-Uniletsp&ewpuearre da luaaprus, qiraca soiMéàart-au-Prince, aoue nfurmvce, aoù sne prmgaimircdepréforme agrecolcfalftnt&moun .sbr> sQilli e dhru ,séaca.,al8217;anaenonc,éoffic rllqsdsucssetésultats,nleNsterétarre d8217;anÉtttràf#anSécuraééspee ii e,ebrong class="spip">JIAaimick Louisstrong>&/,aavoiMédcmn dé0aux cn didttsfe8217;iaenvittrJle rsauartisansu"àsnerras&mn ifeste aviolemnt.,a# saolds t e "&qllleque soiMdleurésultat,aucrp, l deaorvelms detmircàJl8217;ia ssilsdu precrertto l.sbr> sbr> sLcrCEPCavoiMéannoncée#assemarnee#ernièrenqiralaneteiultatinesdun20emarsdavoiMééédee tlchédadppfraudedert&e tlru CiursdNcqntarnesr#e urmcès-verbauxeenvoyésdpsuediffénectsresntsesr#e voteeuvtne / éédeannulés.sbr> sLuddi,fdedeecolcsueo.,erestées fermé,lu uaCap-Haïtruedep&auxeCay s,alsseru dNgai eesnvillssddu u yséapsèsdlaacapitrlenrt-au-Prince, ,ao taindiqué&dedetadios locales. AuxeCay s,avillsaoù des sffronteme ts e uteculièssnt nsriolentseuvtne / euelieueueudécbre ,,fdedee indésdd clséJIMinuctlhp>rong>&/téétntn,lrnaposisnne d saolds t e ,dxissirqilsdsslvéheculesudea#anpolrc haïtruend.sbr> sSasaoattederq laéaee icasinesoffic rllqsdssetésultats,nlesadeux cnmp" uvtne / rpvtddiqué&lanvictor delunct rsadcse#ernierdeursrl,rce q pdlaisseuàfpensu aqiraMirli ecfMuengate#evalitautili e aàarleinulatiérioduNdrurect rsa&#ias8217;iaouvre.sEn&ssccéda./0àJJIRenéaPrevalstrong>&/,tMan lrMsrpelly do tala femme anursééneNgai esrôle da luaapgelonnePdslssécarrièrq eéPsedet / ssécampagne, vaaasecdss0#aatêttdd8217;anund udmisattrasineNampsiéa epcèséleNséismledévaséas, lvdu 12 janvreraq pdavoiMéftnt&psèsdd c250.000amorts.sbr> sComircun eymbtle,rle raeaistisenent M rlédétruiMapsuellNséismlen8217;iaaud8217;avaaies rsdts ursrluras&éédereeteitauit.sbr> sIleorvenrraaa soieueep ysé&#iafoiMéftcq auxedéiteituu cholérane ipaéftnt&psèsdd c5.000amortséeMrà csuxedsv esauncrenstisenent Msedc reorsrN#8217;iaexi . sbr> sLcrstetrd trsrNa&sd effe,aééé marqué,rqilli e dursrluaca.,aleéscrutin,apsuellNreorsrNennHaïtrudcll8217;avuncren usenent MrJIan cBertai esAsn"tentstrong>&/tapsèsdacr aéédechs="éddu uwsvniueetfrécurstpt ansuuedexi . Dsuxemoisdpu dNtôt,eo8217;avéétnt&l8217;avuncren dictatruuebrong class="spip">JIan -Claude Duvalierstrong>&/aq pdavoiMéregagnéolddu ystapsèsd25 ansu#8217;iaexi utn Franc,. Onére tplégit ntmsnté 8217;avlnttdaogsrasur l8217;anlnfluqnc e 8217;ano.,eaudacr asur l8217;anélection,l#8217;iaabordoldddéltso,nt.,edu cn didttd"offic rl",aru sucsseteorsrs (ornisatélbsp;:&?)opourJlenmoins&suapects.sbr> sbr> sNore ,etotalad8217;anéltes, lscinscrr/sbsp;;:C 4,694,961 (chiffresrduéCEP)sbr> sÀaéédeélurxuassetrd trsrNdeséusenent M rllqs (Résultatrurélimasarre)bsp;;:C br> sMan lrMsrpellyGnbsp;?LRepnesepeyizanbsp;;:#187;Msbr> sPourcqntage duévotebsp;;:C 67.57%. Nore ,=de cr xbsp;;:C 716,986< sbr> Mirli ecfMuengateGnbsp;?LRas smblqmsntédeséDéitcrsses NaonneluxePrmgaesltsoqs (RDNP)bsp;;:#187;Msbr> sPourcqntage duévotebsp;;:C 31.74bsp;;:%sbr> sNore ,ede cr xbsp;;:C 336,747 br> sbr> HL/aHaïtrLibrlp>

L />p class="spip">LL23emarsd1511,ert-au-Prince, sbr> sbr> p>

JILds usecrèrssetéactionsédedNon didttsfepcèséleNvoteedun20emarsd1511sth3>p class="spip">LLbrong class="spip">JIHaïtruLibrlstrong>&/anousantmmunci e und sélectionte8217;iaenformasinel,rforcént.,eascomelèé s,aélaboréeaàn# ésuitledu scrutin. No leuréfénosaolds aee isralciabrong class="spip">JIsansucmp s tarrestrong>&/. br> sbr> sbrong class="spip">JINoM deaurecirnMirli ecfMuengatstrong>&/bsp;;:C br> sD saoun,lnoM deaurecirnaee iéra cr21emarsdpsuellNbur,auédeantmmunccdtine d c#aaca didttcrJIMirli ecfH.fMuengatstrong>&/,asignéopsuebrong class="spip">JIPssriccdDuitetstrong>&/,aeor e-psutleedre#aaca didttc,ei tsppécritbsp;;:C br> p>

LLGnbsp;?LIletsppàéuéploeerfcssedet / qiracartains ornisesr#e urecirntne / rioléelds csntsesr#e ommptage ewsdn iff Ce aàadecirin dedetésultatsrderqilli e dbur,auxr#e voteedsart-au-Prince, aa orsaqira crdéommptcfdsslvo/ssen8217;iaavoiMémêmeNpassrncoss0ntp s cépda luaapquasi-totaliéé desRcsntses. Cettcfmn œuvrengrossièr,tuu cnmp JIrJIRepnesePeyizanstrong>&/asti>avile àeuneeauio urmclamasine prmgaimiée. Ce#anestfnt troiss0àe a loidéaqcttrald eMrà #addéitcrssieleeugénérl .< sLa urecirneMél8217;avlnttrne,aso tainfestésdd crum, ls. Onérolluerscrumnt.,a 8217;anambianc deaoravaileduéCEP. Iletsppmalhru ,uxe&#cll8217;avontvetilleetéduiss0#8217;iaexprecinne d8217;anunlsuffragc naonnelrrà qilli e dbur,auxr#e voteedsalaacapitrle.éParaééhie tdetsuarereapectnpwsdnle re p#etrt&lsédéitcrssie, Mirli ecfMuengat neds8217;iaauiourmclamrraajamaisngagnantr.sbr> sbr> sApsèsdacr assntrcié e uteculièssnt nsceie leet&cruxe&#iao MéutenéJlesrNcr xdaué#68,ei tsppécritPd saoeettcfnoM deaurecirn#171;nbsp;?LLcs usecrerdeurmcès-verbauxe&#iae uvruendntéauNbur,auédeanampagneéannonc,np&lanvictor dedre#aaca didttc,eet&crPd saots sp#es déiarteme tsbsp;;:#187;Msbr> sMirli ecfMuengat et&s s0xl#iés&reattn,lvigilt /sseMédcmn de tnàpto ledreneNpasssedlaisser lnfluqnc r psuellslommporteme tsaetemn œuvresddolosifsddsslunsseMédcslauirpd. sbr> sbr> p>

LLbrong class="spip">JINoM deaurecirnMin lrMsrpellystrong>&/bsp;;:C br> sD saoun,lnoMr deaurecirnaee iéra cr21emarsdpsuellNbur,auédeanampagneédu cn didttdJIMin lrMsrpellystrong>&/, signéopsuebrong class="spip">JIAntonio Solastrong>&/, n fédeanampagneédu cn didtt,ei tsppécritbsp;;:C br> sbr> s8271;nbsp;?LNo lestmmesetréisfaitsrdu0dénoul,nt.,edu urmceciustéaqcttral etduJennHaïtrucrPdimacche 20emarsd1510 aLpdecitoyeesehaïtrues,&sasaoexcu Cion,loseevr épenntoué e&#iétudsaet&en=gai esnore ,. Cestéaqctionséreattront, histosae tme t,Jcomirc#8217;ÉOacM deant ssanc dea#addéitcrssielhaïtruend.sbr> s#171;nbsp;?LLaemajosaté deséusmcès-verbaux,éq ernousddéetdonsédéjà,l o leplac,.,a# saound posisnne tcèsécoelortlbl,.bsp;;:#187;M br> sNotss0urce,ipaladener tsp,ureattseMédcmru ,nqiralanvolontéspwpuearre,dxissirqilsleNvoteedesdHaïtruesceMéHaïtruendsasoiMdreapecté. C8217;avtsp&laachoss0#aaeludNimporoa./sa[...] No leexprimosaonsséru dNrrofo dscssntrcieme tsaaux citoyeeseet&citoyeenriéu8217;iaHaïtrupourJlesrNsureor ,JlesrNamrsrNe,el uree tho liasmd.sbr> sNousdattedenosaotai qtilleme talds tésultatsroffic rlsé&#ia#evao tnêts aee iésdpsuellNCEPbsp;;:#187;M br> sHL/aHaïtrLibrlsbr> p>

L />p class="spip">LL09emarsd1511,eeettcftéaction deanotss0amiébrong class="spip">JIGuy Pierrestrong>&/tavt / #es éaqctionssbr> sbr> p>

JIQUE VEULENT LES ACTEURS POLITIQUESbsp;: ?sth3>p class="spip">LL1. Dsru suru CiursdNursrlula urecirnrureor erqilsqilli e -unsédedNaes, lscpolctce tl, &#ian8217;iao taiasavouluNe utecipu aauxtéaqctionsért&e idréclamape tald déiartedu urenent Mbrong class="spip">JIaPrevalstrong>&/ald 7 févritr dernierusesosJlds termlsdd clséCt ititusnne,e eavdulq taiasas8217;iatngagsraaux côtésdd cm8217;anun ouel8217;ava i aadcse#eux cn didttsfàllatisenent c,. Ile smblqroiMémêmeNqilsqilli e -unséd8217;iatntree ux omntinue tnàpréclame aa8217;iaannulatinesdunprecrertto lfdedeeaqctions.sbr> sbr> s2. Ile srant&sasaodoué elntéiesst s deantentîtrq lesartis (lupourJlesqurllqaoe acunddsucsseaes, lscadoptcfeettcfposisnne aL8217;anonniwuraltcallsldiscutrr,flssee elonneneraep&anime aundgai esdéba .rMsiseàrqilli e dursrludu scrutinedun20emarsdue telddéba Cneustrant&iasafauctueux cnrei ss0#imitsrant&sasaodoué eà soulrgneréunci eme talds surtrcherilsdd cPrevaléq ernousdntent ssonsats s, ouéàaégreneralds aes,sadppfraudeeduéCEP. Oral ésasnnesfoiMéftcq àuu(ddangerbsp;;:C&lesrduvaliértsoqs vdulq taec ld#crreorsrN#u dictatruuebrong class="spip">JIan -Claude Duvalierstrong>&/arepnecdss0#e uwsvniu.ILcrcn didtt-chantruueursi,edp # ureepru . Ls0uwsvniueobsssvs0#e jeu maisnneds8217;iay opposeepas a orsaqi8217;ani ddasros deaos sp#es moyeeseiwurafarre arrêtursetsjuger,écomirc#eédcmn de tnlpdecitoyeeseeMédirselescinsoa.cssdent rnaonnelres,e crdictatruueewsdnerimes cofearJl8217;avhumn iéé. br> sbr> s3. Ileteci rMéutec qilsles aes, lscpolctce tl, &#iass0#imitsn,lrncoss0à=exprimerJlesrNdéii,edp n8217;iaavr aras pucforc,rcPrevaléàeornisat,rc#171;nbsp;?Lu(dbonnprecrertto lbsp;;:#187;Mart&lsisser #e uwsvniuald 7 févritr,e eaemmpnecnq taiasa#assitudtine ftcq àulaqurllq ledu ystse orvenr. Ille eavoie taeas qiracallq-cidaetotalsnt nsc angé deeuisr#rPdimacche 16 janvrer,ert&e tll8217;iatntréa soudarnee#uachantruu-ommpaldssdn#a scède rolctce tdneatradunt&iasaueN#171;nbsp;?Lsimp e aes,ecitoyeebsp;;:#187;Masino(&und straségie brueucalculéc,fsoiMécrllq du0stes, l rolctce tde ipaéabusédd clsésasnnessedet / ru dNd8217;anunei artedd sièclr.sbr> sbr> s4 aLpdeaes, lscpolctce tlddoive tnmieux&ass mer lesrNreaptnsabiritésau®arddd cm8217;anHistor d. Illedoive tnaentrJlsésasnnesàum(ttree namarche undprmceciustvisa./0àJneutsalate eMrà sdddébarras srdàécturtetermlededNonbotins #171;nbsp;?LPreval-I iéébsp;;:#187;M.=Illepeuve.,al cfarre edulqmsnt&en=évitt / qi8217;anunea i aaonbotinfennlaarersoenee#uachantruu-on didttdns0succèdtrà csse#ernierd.&La csn"elnaonnelre tspporvpdgaiveteMretmp exe ewsdnétirqr davt /agc lq lg clayclqsdsucnbotinagc aLpdeaes, lscpolctce tldsave tnmieux&e tde iconqu,nqiralansasnnesaccélésera&saamarche vselel8217;iaabîmeaec ld#crchantruu-on didtt. Pourquoiéutec eavdulq t-i s&ras&#énonc,rvldddanger et&s ba t d ewsdnqira ansasnnesneatoree&passuns0nvenrele foisdss sp#es bot/ssr#u duvaliérts sbsp;;:? Etdns0reattsras&égrlqmsntépris (nièrendcll8217;avunarcho-pwpuets sbsp;;:? br> sbr> sbrong class="spip">JIGuy Pierrestrong>&/sbr> sbr> p>

L />p class="spip">LLrt-au-Prince, ,amarsd1511sbr> sbr> p>

JILANCEMENT DEaL8217;an AMÉNAGEMENT D8217;avUN CADRE DEaLIBRES EXPRESSIONS PROPRES AUX FILLES ET AUX ADOLESCENTES Àll8217;avOCCASION DU CENTENAIRE DU 8 MARSsth3>p class="spip">LLbrong class="spip">JIEspas ps mwenstrong>&/a(MnesRés,aué#8217;iaExprecinne)opourJla0librtééaucrp,nsétseMédc psutleedrsélil#es/adolsscsd/ssr# saoun ntfetxM deadéséquilibrl&dedetareor sésocilux&htmir-femme.sbr> sbr> p>

LLEspas ps mwenNewsdnrrev diral écoelormasine desélil#es/adolsscsd/ssrlux&idéglogiesrdéfavrrllms dà lesrNimp icasineécoecrèttseMéfueu ,pda luaaptransformasine dea#ansociééd.sbr> sbr> p>

LLEspas ps mwenNewsdnrerm(ttrq auxelil#es/adolsscsd/ssr#eNe utecipu alibrlme tar,erleinent.,a# saolaereeteitauction d8217;anHaïtr.&La sociééde# saosne étatracsurldns0sluraiMéirutransformervs saolesrNnéceciarre ntfeaibutine.sbr> sbr> s150elil#es/adolsscsd/ssrs8217;iaexprimeront&en=toué elibrtééassdn#esreapect deaes rsddroiMsa# saolaesociéédehaïtruend acsurllqcàJl8217;iabrong class="spip">JIHôteldOlofs (btrong>&/,t# saol8217;ÉOaerès-midi duévecdssdi 11emarsd1511,ed c2 hru ,sée.m.càJ6 hru ,sée.m.sbr> sbr> sLedeaes, lscsocilux&conc,rnésdpsuelludnmod d8217;an xcu Cionsd saolddurmceciustdere angdme tasero ta#es brueves sa# saoEspas ps mwen,acsdrrcdepréflexions0nvenrelemsntéaménagésdpsuel8217;iaAPROSIFAapwsdnmi ux omnsolcntrJlsént vicsine desélil#es/adolsscsd/ssrnt icruetisées (ouerassrncoss) psuelaanéceciité deae angdme tadeaes rsdséasuMsa# saolaesociééd. sbr> sbr> p>

L />p h3lass="spip">JIÉaqctionsért&droiMsa# cm8217;anHtmirsth3>p class="spip">LLbrong class="spip">JIMin lrForststrong>&/,aL8217;iaExprtéaindésedet / des Naonnes Uniesessdn#assitudtine dcse#roiMsa# cm8217;anhtmircennHaïtr,raéepeesdehrertjeud , sesucn didttsfàll8217;avélectiontisenent M rllq àé 8217;avlmp ie tra# saolaelut/s cofearJl8217;iacmpu iéé. br> s#171;nbsp;?LAuémtmeseeoù ledu ysts8217;ÉOaeprêturà chois asne prmchaietisenent M, jeusnuhaiteaqilsdsslengagsme tscsoleenels soie taeriiéu saol cdomarnee#ese#roiMsa# cm8217;anhtmircetaqilsdsslsignlux&soie taenvoyésdpwureunRru dNgai esreapect dese#roiMsa# cmaarersoene,plapréforme #ddlanjticice,olaelut/s cofearJl8217;iacmpu iééaesé#8217;ÉOaccèsddeaos splux&servicssr#eNbasebsp;;:#187;M, aadatfM.bsp;;:Forst.sbr> sL8217;anExprtéaindésedet / sfoiMéueolaelut/s cofearJl8217;iacmpu iééam8217;anun dedNaxs ddc saavilitt0etddef esarrncontsesrac ld#eséauiorttéstdu u yséetflds tepnenentt /ssdralanetmmunasiéaent rnaonnelre. Gnbsp;?LIletsppimporoa./nqira anlut/s cofearJl8217;iacmpu iééapa leeraralds voiesnjtdeciarres,ert&jeusnuhaite,opourJla0mémor dedrsnvictimes,e&#cll8217;avontexploeettoué aolds aossibiritésPd saoeecdomarne,énotamnt.,aeourJleséerimes lsseru dNgaivestdu u ="édsasattrenqi8217;iaauntenu ledu ysbsp;;:#187;M, a-t-i vrepeesé. br> s#171;nbsp;?LCssedet /,olaelut/s cofearJl8217;iacmpu iééaneds8217;iaarrêtuepas aux&voiesnjtdeciarres,ei vy alégrlqmsntédeséuam sureléme tarresdà&frunchiraenrmasiè ,dde0mémor d,dd8217;anéducasine,aucrpsn"eldeantescruece. D8217;ava i amau yséuedAmériqirnLasinsaet&en=Afriqirno.,eutiltté dds voiesnnovssriccsdpwureexorciserJleséerimes du u ="é.nHaïtrugagneraet àé 8217;avlnip"rerddsucsseexpéi r.cssbsp;;:#187;M.sbr> sApsèsdacr avilitéuru CiursdNpris (séetf 8217;avêtree ntreetduJac lddssnore ,uxemagattrass,é#8217;ÉOExprtéaindésedet / srepeesénqira anréforme #ddlanjticice,oeppnotamnt.,a 8217;avlndésedet c,tuu uwsvniuajtdeciarre,atsp&bloquédadpru suru CiursdNsenées.n#171;nbsp;?LLcs éléme tsueo.,elà,plapréforme oa./nastede te#s0#aajticice a&éédeécrittdetsadoptéeeraraldfParl me ta orsaduévote dds 3 loisessdn#asréforme #ddlanjticicee na1507.&La loidtsp&là, maisnrllq neére tp ntrer&sd vigu urecsuelaaclédd clséréforme,écrllq &#iaeerm(tadppfarre to lneraldémts, l,en8217;iaauras&éédeutilttér. Vs spleésac z,eeettcfclédtsp&laanomasasnnesduebrong class="spip">JIPsenent Mrd clséCt l deaCs="asnnestrong>&/,alaaclédd cvoûtendcll8217;avédificebsp;;:#187;M.sbr> sD saol cdomarnee#en#assitudtine humn iéar d, 8217;ÉOExprtéaindésedet / splaidéspwsdne 8217;anund pu dNgai eelatttn,nnersoiMéaccnrdéq auxedroiMsa# cm8217;anhtmirc# saolaereeteitauction.n#171;nbsp;?LJervoudrtissrepeesu aqira 8217;an au,a crlog me t,e 8217;ÉOaccèsdlux&soinsnnedso taiasaqilsdsslbesoins&humn iéar ds. Csaeo.,edes droiMsaexigibe leet&jeusnuhaiteraisrqira 8217;avonts8217;iatngagsamaintenanéP# saolaevr eénéceciarre pwsdngara tir, au-delàsdralanesn"elhumn iéar d, qiracas droiMsasero tabrueugara tisdpsuel8217;iaÉtttrhaïtrue. J8217;ÉOaisrepeesénà csp&igardae 8217;ani dseraet urge taqiraldfParl me tarssifiraldfPacé elnt rnaonnelrptelasnf auxedroiMsaéeteomae tl, socilux&eMreultur,ls,Nafine#8217;iatntrer prmgaeciivent.,a# saoeettcfnoenrele dynamiqirndee 8217;ÉOaccèsdàots sp#es droiMs,vy emmpnisp#es droiMs urmclamésdpsuecs0u ctebsp;;:#187;M.sbr> sLa septième miiline defM.bsp;;:Forsted saolddu ysds8217;iaachènrraadimacche 27 févritr,eete Saprmchaietrareor tde 8217;ÉOExprtéaindésedet / seal&pnenentéeeMédiscutépennjuina1511u uaConsei #ese#roiMsa# cm8217;anhtmircdes Naonnes Unieseà Genènr.sbr> sbr> sEn&sacr arlusnssdnbrong class="spip">JIMin lrForststrong>&/bsp;;:C br> sLe Sterétarre générl cdes Naonnes UnieseaanomméfM.bsp;;:Min lrForstécomircExprtéaindésedet / ssdn#assitudtine dcse#roiMsa# cm8217;anhtmircennHaïtrpennjuina1508.fM.bsp;;:Forstetsp&Sterétarre générl cdeclséCtmmiiline naonnelre eteiultativee#ese#roiMsa# cm8217;anhtmirc# cFranc,adpru su1505 e,atsp&l8217;ava i, l dearu CiursdNouvragcsassdn#esé#roiMsa# cm8217;anhtmir,e 8217;ÉOextrêmeNpauvreééaesé#es Naonnes Unies.sbr> sbrong class="spip">JIHL/aHaïtrLibrlp>rong>&/sbr> sbr> p>

L />p class="spip">LLInformasineldent rnaonnelressbr> br> sLanmasattrendcsdAffarresdétiangèrqsdd clséCtltmbie,ebrong class="spip">JIMaría Ange#anHolguíestrong>&/,aré nncfeettcfsemarneeà Bogotáaec ld#crSous-Sterétarre Générl cadjoastedu Départeme t dsslopérssinesed cPaixa# cm8217;anONUeete San fédealséJIMiiline des Naonnes UniesepourJla0Stabiritréiontd8217;anHaïtrstrong>&/a(Minuctlh),ebrong class="spip">JIEdmtrd Muletstrong>&/,ao taantecipéam8217;annrdr,tuu jrsrN#8217;iaacri prmchaie, orsqilslséCtltmbie&ass merallatismchaiedéprenent c JduaConsei #enSécuraéésssdn#assitudtine ennHaïtr p>

LLLséCtltmbie&aaenvitrgé,Nac ld#crConsei #enSécuraéé,v adrwssibirité deaoransformerv adMiiline dev adMinuctlh ennund opérssine deadéveloep me tepourJHaïtrbsp;;:C«nbsp;?LPwsdnle gvenrrn me tactltmbien,ei tsppimporoa./ndeantetinuersd saolddurmceciustderstabiritréiontennHaïtr,ro8217;avtsp&uecfe tlsnnesd8217;avlntéiêtoiwurfl8217;iaAmériqirnlasinsaet&#es Caraïbesbsp;;:#187;Mosédé laré María Ange#anHolguíe aToué fois,r# saoun ntmmunci é,e a daplomatruntffirmeaqirac ttcfrwssibirité deaoransformasine dea#anMinuctlh seal&déba t tdetssoué due psuelaaCtltmbie&àcm8217;anONUelunct rsaduemoisd#8217;iaacri .ILcrctmmunci ééprecise qiraca déba Cseal&animéeraraldfPsenent Mrctltmbienel p-même,ebrong class="spip">JIJuanfMueurldSa./osstrong>&/. br> sHL/aHaïtrLibrlsbr> sbr> p>

L />p class="spip">LLHaïtr,vle 16 févritr 1511 br> sbr> Haïtrp-&Reeteitauctionbsp;;:C&Msengat et&Msrpelly rrncontsenp&lanCIRHsbr> sbr> p>

LLLe=PsecrertMasattrenbrong class="spip">JIan -Max Bellutivtstrong>&/ tte 8217;ÉOex-Psenent MrJIClintonstrong>&/, no-Psenent Mrd clséJICmp iiline Ietéi marre iwural éReeteitauction d8217;anHaïtrstrong>&/a(CIRH)ao taornisatéehrertund secinne d8217;anenformasineaeourJleséen didttsfàllatisenent c,. LanCIRH alégrlqmsntéaccueilli des mbre ,srduéClub defMadridseMédcsltepnenentt /ssdral8217;avUNESCOae,adppaanCARICOMaqiiuo.,easenentéees rsdséraségiesessdn#asmeaies re foçnetdd teiondrq auxebesoins&specifce tldd saol8217;ÉOeffor tde reeteitauction.sbr> br> sLosdNd c#aaré nnne,a e=PsecrertMasattrenBellutivtda soulrgné0aux cn didttsflaanéceciité qilsles oravauxr#e reeteitauction se iwursuive tnsasaoe trovuNlunct rsadcllaaoransisineaeolctce tdà v diraep&au-delà.ILcrPsecrertmasattrenalégrlqmsntésoulrgné0la foncsine dea#anCIRH,f esaprmgaèstàlcenjrsrNe,esne plandséraségie tde ipgucntrasles effor s fueu s. Ile srepeesénqira anCIRH estfnhargédadppfaciriteralds usmjeMsedc reeteitauction défen sdpsuellNGvenrrn me tau8217;iaHaïtrupourJteiondrq auxebesoins&du0ue p#erhaïtrueert&e tlleRmn dttadp m8217;annrnisatréion arrivtdàcée éanc,aueeOctoe ,a1511,edatq àulaqurllq esafoncsinesasero tatn,nèssnt nsass méesdpsuellNgvenrrn me tau8217;iaHaïtr. sbr> sbr> sL8217;anex-Psenent MrBaie Clintonda soulrgné0l8217;iacmporoa.csadu urmchaietgvenrrn me taewuraass ru a#aaeleiedép utecipasnnestte 8217;ÉOengagsme tsdralanetmmunasiéaent rnaonnelreNafine#8217;iaass ru aunlsouérueueermanq t.n#171;nbsp;?LHaïtruasfoiMéuesaprmgaèstdeeuisr#rPtremblqmsntédeeterre, maisnje croisaqilsdsslprmgaèsteludNimporoa./ssrncoss,&conc,rna.,al8217;anaméliorasine dea#anvie&du0ue p#erhaïtrue,usont&rwssibltldd saolatismchaiedésenéebsp;;:#187;Masoulrgna./nqira#171;nbsp;?LLaeCIRH estfundforumndeantllaboration sanstisecéde taqiiaexiattsrwuraacntrJàsrncouragsralddurmceciustderreeteitauction,dss sp#a&uirtesnnesduegvenrrn me tahaïtrueert&nousdallonsaoravailsu aec ld#crurmchaietgvenrrn me taewurantetinuersàal cfarrebsp;;:#187;Ma br> sbr> #171;nbsp;?LCeauirqilsleNue p#erhaïtrueechois aniwurnêts #crurmchaietn fédeal8217;iaÉttt,Jlenmois prmchaie, luranàprelev,rvldddéfe sérrduxedsv adreeteitauction.nMsis, #crurmchaietusenent Mru8217;iaHaïtruseal&d saound posisnne sanstisecéde t, sesufo daonnes iwural éreeteitauction so Méuéjàe naelac,bsp;;:C&l splanificasinesséraségie t, m8217;annrnisatréion tte 8217;ÉOétlblissemsntédeersutenariatsueo.,een=gai edép uteeéuéjàerédli ésugrâc,tlunoravailedra anCIRHbsp;;:#187;Moséftnt&sacr a e=PsecrertMasattrenBellutivt.n#171;nbsp;?LApsèsdlaaré nnne&d8217;ava jrsrd8217;anhui, jeusu suct vaenc rqilsJIM sbsp;;:Muengatstrong>&/ tteJIM.bsp;;:Msrpellystrong>&/ o.,eto ledruxel éreeteitauction comircund priosaté naonnelre ttei saoseea soieueesmeaies re emmpnéhensine dea#anCIRH,fdefson rôle etddef esarédli aonnes.bsp;;:#187;M br> sbr> p>

LLbrong class="spip">JIMirli ecfMuengatstrong>&/,a#aaca didttcrdueRDNP,aasect s laupsutleeàac ttcf5earé nnne&dea#anCIRH,fanestiméeqilslséCtp iiline luraiMédûel érencontserabrueuavt / c ttcfdttcren=ta./nqirareaptnsablqsdsup uteaeolctce t. Sne nt rvtn,nne éétnt&fo dés0suredruxepoastsbsp;;:C«nbsp;?LJ8217;avtspimeénéceciarre etaindisp,nsablq ewurfl8217;iaavesirddeanotss0p ysé&#e soiMdass réralanetetinuitéssntsee 8217;ÉOengagsme tspnisppsueueagvenrrn me tahaïtrueelunnom deél8217;iaÉtttrhaïtrueppsueueaa i aagvenrrn me tae ipag anesse t rllqmsntéaunnom duémêmeNÉttt. En&ssetrd lieu, j8217;ÉOaisaelryséelds docume ts ptoduits,erere uteculierfcsauirqiruasfoiMém8217;annbje,adp #adntffénecc deaNew Yorkeet&crauirqiruétlblite Sabilanddrc#8217;ÉOacMiontenttepnn"eldeeuisrueaanaet&#es rerspectiv lededNaesnnes àtenttepnecdss0avt / #apfine#uRmn dttadp mséCtp iiline...bsp;;:#187;M, aaexplci ééMirli ecfMuengat. br> sbr> #171;nbsp;?LJe croisaqilslaaré slitt0dsslengagsme tscsouscrr/suseal&brueuenttnduabénéfiqu pwsdnleNp ys, maisna soiecomircpneuvee#en#asgénéroiité qiida&ntndunt&oa./ndeastes, lscdralanetmmunasiéaent rnaonnelreNà v diraenaacntNà HaïtruapcèséleNséisml,oeppn8217;ava rauras&ééde#8217;iaexprecinne d8217;anune émotine... Ents #crnirsauédeanssébesoins&etflds ttis (nllms datttn,tl, je croisaqi8217;ani dy aaelac,tpwureunRa i aaengagsme ts&#iano lerevre.,aàano l,dHaïtrues aL8217;anavesirddeanotss0p ysétsp&nôtrebsp;;:#187;M, a-t-rele dé laré tt enéreetent ssantéq ernousddevonsna soiecomptsrasur l8217;anacntNdrc#8217;ÉOent rnaonnelr. sbr> sbr> sPour saae ut,vJIMin lrMsrpellystrong>&/ aavouluNevecirra anCIRH àdalle arlusnvittbsp;;:C«nbsp;?LOnéadattaqué&ledproblè srau uoastede vu humn iéar d. Je croisaqilslaaCIRH doiMéjrsu aunlrôle imporoa./nd saol cdéveloep me ted8217;anHaïtr,vsédé laré le cn didttddra#117;an#117;anRepnesePeyizan#117;an#117;an.éParaaaies rs,tMan lrMsrpelly alformusénqirli e de tlsnnesdà l8217;an n#roiMédeséuautecipa ts.«nbsp;?LPwsdquoiéneNpasspensu aàJl8217;ia nt M ficasinesdedecitoyeesehaïtrues dèsdlaant ssanc bsp;;:? No lestmmeselàéau u ysécomircsiuo. n8217;avtxiattsras. Onérarl ldeantestauction mod rne,atsp-c e 8217;ano.vsédéjàeaee iéflds normelbsp;:&? Siuoui, tsp-c e 8217;anrllqaoso Méuasronibltl,aru se t, moi, je n8217;ÉOaisrassrnttnduararl rbsp;;:? Esp-c e 8217;ano.vséabordé&ledproblè srduazoning, le cndaitat, m8217;anéducasineN&#iajrsuaunlrôle tcèséimporoa./nd saomne prmgaimirbsp;;:?bsp;;:#187;M br> sbr> SesosJld cn didttdau useudo«nbsp;?Ltèt&kalebsp;;:#187;M, l8217;ia gnoranc,atsp&leavdes, l qiiaengederq laéaauvreéé.«nbsp;?LJ8217;avaisvuacartaines usmmbsiesdu saol cdocume t&dea#anCIRH,fmsiseàrqill uoasteeeNtsp-onbsp;;:? Lanran leed8217;anunep ys, csaeo.,e esarrssourcqs&humnines, a-t-i vdit. Iletsppimporoa./nqi8217;ano.vinvtlsn leed saol8217;ÉOhtmirchaïtrue. Aurnirsauédea#anCIRH,fo.vsénr épund faibltlleed saolanetordasasnnessntsee esérsutenarresédp mséCtp iiline,nleNstes, l rtivé, sesunrnisatréions no(&gvenrrn me tae leet&llNgvenrrn me tahaïtrue,u&#ianedso taiasats ursrluarrivéséuedharmneatréion tteen=toué etaanspanecc,.bsp;;:#187;M br> sbr> sLpdetepnenentt /ssent rnaonnelux&ievitésaoseeabordé&troisessjeMseimporoa./ssiwural éreeteitauctionbsp;;:C&leerenforcrnt.,easititusnnenel, m8217;anéducasineNe tde renforcrnt.,ededNonpaciéés.sbr> sbr> sJIFeliplNGvnzálezstrong>&/a(ex-PremrertMasattren#8217;iaEspagne) tteJILinell Joip"nstrong>&/a(ex-PremrertMasattren# cFranc,), mbre ,srduéJIClub defMadridstrong>&/ o.,eissisééassdn#esrenforcrnt.,easititusnnenel, repeesantéq erséismlede janvrera1510davoiMégaivemsntéaffectéalaacapaciéé duegvenrrn me taàafoncsineneraefficaclme tar,eàJteiondrq auxebesoins&immédiatsueMrà #g clterml.=Illeontésoulrgné0q te# saoles moiseàrvesir,«nbsp;?L#esrenforcrnt.,easititusnnenel vaaasecdss0und cmporoa.csanoenrele ac lddssléaqctionsédéitcrssii e dmarqua.,al8217;anarrivéeed8217;anunenvenrau=usenent MreMrParl me t.sbr> sbr> sLcrthèmendcll8217;avéducasineNalégrlqmsntééédeabordé, repeesantéq erdeeuisr#rPséismlede janvrera1510, 90%ddsslééudia./sshaïtrues eo.,ereto lnéséuedsallqsdsuclacirneMéqilslaaCIRH avoiMéftciliéé desRusmjeMseaxésessdn#asreeteitauction dessenfraitauctur,suéducasiv leet&la fo rnieu ,pdeérepas etadp m8217;anrau=uotablq ewurflsslééudia./s.sbr> sbr> sJIMan aëllqsan strong>&/,a#8217;iaEnvoyée Specialendcll8217;avJIUNESCOp>rong>&/tpwuraHaïtr,vsérarléddu uwsvniuedcll8217;avéducasineNau-delàsdralansallqsdsuclacir.éPu dNrreciséme t,erele a mtn,nnené0l8217;iaéducasineNcomirc#171;nbsp;?Lu(dcaslrys,uueewsdnl cdéveloep me teéeteomae t etaun outi posdn#esrenforcrnt.,e#ese#éitcrssiesbsp;;:#187;M. D saosne allocusnne,eMan aëllqsan raéepeesdeàeuneer fo./satotals du0systèmenéducasifshaïtruebsp;;:C«nbsp;?LIletsppimpérssifédeam(ttree naœuvrenldfPacé eNaonnelréewurfl8217;iaÉducasine,aq pda&éééaélaboréeraralds auiorttésthaïtruendsaduemondendcll8217;avéducasineNe,aapprvenéeraraldfPsenent MrdralanRépee ii e. Csaplandj ttcf#es basescdralaneteitauction d8217;anun eystèmenéducasifsacceciiblt,eueirselelaqiiuoffreaun neergneme tade qulriéébsp;;:#187;M.sbr> sbr> sL8217;anAncren PremrertMasattrenjamaïcaie, brong class="spip">JIP.J.éPattcrs (btrong>&/,tRepnenentt / Specialrd clséJICARICOMstrong>&/ tnnHaïtrp&#iasièguNlunctnsei #en#anCIRH,fanégrlqmsntéfoiMéuedéprenentttion repeesantéq eraanCARICOMas8217;iatsppengagéeaànrenforcrralaacapaciéé asititusnnenells du0gvenrrn me tahaïtrueern&ft rnisst s l8217;anasltsoa.csatechnie tdetsdefsoutrue. LanCARICOMajrsuaégrlqmsntéunlrôle aesnfa# saolaereeteitauction d8217;anHaïtr,aoravailsant&en=étroiteantllaboration ec ld#aaCIRH dansédedNusmjeMsedc reeteitauction des asititusnnessdral8217;avÉttt.sbr> sbr> sD saosne allocusnne,elcrPsecrertmasattrenPattcrs (nalégrlqmsntésrgnasdeson désil deaoravailsu arere utenariataec ld#crbrong class="spip">JIPsmgaimircdes Naonnes UniesepourJl cdéveloep me tstrong>&/a(PNUD)aewurantetinuersde ntfeaibuer àdlséreeteitauction d8217;anHaïtr,arere uteculierfu saol cdomarnee#u renforcrnt.,ededNonpaciéés asititusnnenellssbsp;;:C«nbsp;?LD saol cdomarnee#en#asformasineae,a# saolds onpaciéés asititusnnenellss,elcrPNUDére tpêtren#8217;iaundgai essect rs. No lenene trchons&passàpfarre ce#antt eduls.bsp;;:#187;M br> s(1) Lcs usmposddcse#eux cn didttsfeo.,ecruxeexprimés lunct rsaduehu suclos tels qiracitésPd saolcrctmmunci ééoffic rl #en#anCIRH sanstaucueesmtdificasine.sbr> sbrong class="spip">JIHL/aHaïtrLibrl /nCIRHstrong>&/asbr> sbr> sbr> p>

L />p class="spip">LLHaïtr,vle 2 févritr 1511 br> sbr> I dy aavalint.,ebrauct p àedireessdn#asurenenc,tmalfarsa./sa#u dictatruueDuvalierNà Haïtr. No leavonséreçuddcsetémorgnagcs,édedNuseuves du0systèmencorrompurqiruétlite Sasrue,udedetéactionsédeansséa ii. En&vnicisqilli e -unes.sbr> sbr> p>

JIHaiti-Duvalierbsp;;:C&Nernousdmobiritons&passedulqmsnt&ewsdnror ersplaints cofearJl8217;iauncren dictatruusth3>p class="spip">LLvecdssdi 28 janvrera1511 br> sPsuebrong class="spip">JIGuy Pierrestrong>&/sbr> sbr> * (SoumiseàrJIAl erPrecirsti>ale 27 janvrera1510)sbr> s1.&La situdtine naonnelreNs8217;iatsppeteiidérllmsmsntéaggaivéeaec ld#crdébari eme tainop"né,vle 16 janvrera#ernier,ddrc#8217;ÉOancren dictatruuebrong class="spip">JIan -Claude Duvalierstrong>&/aàJl8217;iaaésmport ent rnaonnelr. Et&crPd8217;ava ia./nqi8217;anlunlieued8217;aném(ttreeimmédiat me tactfearJluieunRmn dttad8217;iaarrêteet&llNfarre umnt.era#irtesqmsnt&en=pris (,rce q pdluraiMéitetréeqilslsésasnnesn8217;iatntecd&passrevrvsee esésenéesrnorresédp 1957-1986,&llNgvenrrn me taasfoiMéacommpagneraM.bsp;;:DuvalierNà son hôteldpsueue,atscor erpolrcnèss. Dsru s,a#aae tlsnnesdssléaqctionsétsppteléguéq au&ssetrd planddrc#8217;ÉOacMulriéé. Un déba CsurJleséerimes ctp iidpsuecsauirqilsleNue p#eraechs="éddu uwsvniueld 7 févritr 1986dtsp&lancé. br> sbr> s2. Csadéba Cent rprllq lesacitoyeeseet&citoyeenriésur l8217;anun dedNurce,ipauxeproblè ssedeNbaseeqilslsésasnnesdoiMérenoudre&ewsdnrosvniueavt crr,flsdproblè srdddlanjticice.&La sasnnesneare tp ncoss0orvenrraunRmoyee ewurfl8217;iaabordsrasérrduslme tar,erusirdto lecruxe&#iapilsu ta#es csissessdral8217;avÉttt,aq pdasstsltnt.,ededNoitoyees,aqiiaexploitsn,lcmpu éme talds brenstiee icdNoua&#ias8217;iaenran isse t psuelaactfearbi ec. Un nore ,etéduit d8217;anendividus etadp sualittsddeaos /ssrsor el,rforsqmsnt& iésdauxr#iffénectsrgvenrrn me tse naelac,,ds8217;iay oppose t.nLedeargume ts qi8217;anlvt cr talds avoca/ssdral8217;avancren dictatruuelenmontsenp.nLedebaelrttéstégrlqmsntéqiraldfPsenent MrdralanRépee ii evsédévidéssleneterre&vniltnt. Du0reatt,ntt comirc#es avoca/ssdral8217;avancren dictatruueet&crrtains htmmesepolctce tldeeeintellecsurls,&llNgvenrrn me ta eavdutaiasaqilsjticiceesoiMdrede t. Ilee trcheaànbaelrtirra 8217;avaffarre etaommptcfewurane#ansur ru CiursdNfaes, ls. br> sbr> s3. Ilefa tp ncouragsrato lecrux,ttoué aolds victimesededNsévicssr#es htrdssr#es DuvalierNà ror ersplaints cofearJleaoyranaet&àpréclame ason arrtctltine eesfoist s precinne sur l8217;anÉtttrpwsdne 8217;ani ass mee esarrsptnsabirités,ro8217;avtsp-à-direeqi8217;ani ddé lare,Nac ld#8217;avapru ddeaos /sslsésasnne, qilsles erimes ctp iidpsuean -Claude Duvalieranedso taiasapreceriptibe leet&qi8217;ani ddoiMdêtrenjugé,Ncomirc#es dictatruudeargtn,nnsédedNaenéesr70-80.&La sasnnesréclamenjticice.&Dssnore ,u esacr xdent rnaonnelresd#8217;avapru e tar,elu ddemn de tnd8217;iaagil.sbr> sbr> s4.rMsisei dy aaeludNgaive.aCtferoissme taàacerqira 8217;avontiwuraltcaemmpnecdre,NapcèséleNct p mi qté deaJIRogsraLafo./a tstrong>&/aees1990,nlesaduvaliértsoqs n8217;iao taiasarenoncéeàJl8217;ia nédadppirnréinsoalsu aeu uwsvniu. D8217;avaaies rsdcrrtains d8217;iatntree ux o.,eaue iéfrécbrme t dsslouvragcsaeMédcslaffichestvisa./0àJprenentu a#aaeérioduNdru1957-1986 d8217;anune foçnetdiffénectqsdsucrllq &# cm8217;anhistor drmasérilrtira# saolds ouvragcsa#171;nbsp;?LPnpa Doc&etflds Tonton dmacoué aoet&llNPrixa#u sangbsp;;:#187;ModeaJIB rnard Diesrichstrong>&/,aounLedeComédiensédeabrong class="spip">JIGraham Greenstrong>&/. OnénoM rauraraaaies rsNac ldlntéiêto&# can -Claude Duvalieraete Sann didttdJIMsrpellystrong>&/ o.,eles mêmes cofseaiessdNuuridce tl...sbr> sbr> s5. Ilene fout&sasaodoué epasssedhâtersde ntfclure, maisnlaactïncrnt c Jsurasecd. Ellq méritrPd8217;avêtree xplci éc aLpdesvenrsirsédedNtelasnonsédea#171;nbsp;?Lbambochebsp;;:#187;Mod8217;ava ir foisepeuve.,asasaodoué eacntrJàsllNfarre. En&tt cas,aunrunhoss0tsppeartainebsp;;:C&M.bsp;;:DuvalierNtntecd&orvenrr,usesosJldnprecrertdisct rsa’ani adprononcé,eunRrouearnupourJtehabiritsratotrlqmsntésonupèrq eéP#esrégimledéchu.ILcrchantruueseraet Sann didttdrarfoiM.sbr> sbr> s6 aToué foisalanstraségie desaduvaliértsoqs pourJirnréinsoalsu aeu uwsvniuCneust0#imitsrant&passedulqmsnt&àv adrwssibirité deaconquértr Sann didttdass="é&troisième d saolds tésultatsrurélimasarresrduéCEP.ILcrcnmpédeabrong class="spip">JIaudsaCéaqstasp>rong>&/,are tpa soi,ds8217;iail0reattsd saolanet rse,JlesrNservirsde marche-pied. Cscrpennttis (rduéfoiMéqiraldfgrvepe q pdl8217;avapru e estfundramasltsd#8217;iaacsnturrerdeeeN&#êttdd8217;anargtn, etadp cretttsddeaos /ssrsor el.=Illeso Méuasronibltl. Csrtains stes, lscdraJILlvtss=p>rong>&/tégrlqmsnt,eet&crPd8217;ava ia./nqi8217;anillepeuve.,aen=profitsrapourJirgneréac ld#eséduvaliértsoqs unéaccnrdassdn#esreorsrN#8217;iabrong class="spip">JIAan"tentstrong>&/tau uwsvniu.sbr> sbr> s7. Comircns spleévoyonsédonc,n#assitudtine esppextrêmeme tactmp exe.&La sasnnesse orvenr brusi eme taàenvenrau,ro8217;avtsp-à-direectmircenn1990,nftcq auddanger #u retrsrNau uwsvniuedclcruxe8217;1;d#eséMml.=JIMsx Adolphtstrong>&/ tte eséJILuc Désilstrong>&/ - q pdl8217;avo.,eempêché brutrlqmsnt,erarasadismleet&cynisml,od8217;avaccroîtrq etnd8217;iaaméliorrr,usedet / #a&uruxième moiMiéddu XXd sièclr,«nbsp;?L#espeubsp;;:#187;Moe 8217;anrllqCavoiMéaccumuséndurt / #a&Druxième Guerre&Mo dilre tte#a&Guerre&dsaCorée.sbr> sbr> s8. Ilefa tpbarru a#aaroué eauxr#uvaliértsoqs.ILcurJtetrsrNau uwsvniuepsuellNbiaisn#uachantruuaoun#8217;iaundllvtss=sruesqillconqu,naggaivsrant&davt /agc ncoss0lanesn"eld saolaqurllq ledu ystse orvenr. Lcrpilsage des csissessdral8217;avÉtttNaugmentu ant,udedecqntarnesr#e millierded8217;iatnfa./ssntetinuerare.,aàaêtss0urcvéséd8217;anéctle,rleslommpssrio/sseq pdvive tnss sp#es ttn,tl deeuisr#rPtremblqmsnténtetinuerare.,aàay croupir,flsdsystèmende ptoductine naonnelrsnearwuraltcaiasarepnecdre,N#es gai eesne tlsnnesdfoncrèrsseetnd8217;iairrngatnnesretoreerare.,ad saol8217;ÉOvelmr,vle coûMrdralanvie&nrPdiminuerarcaias,vle nore ,edéjàeimprecinnena./ndeasansaoravail etadp chôms rsNaugmentu ant,ulenmouvent.,a#8217;avtxoduNdrucsdrrs etadp oravailsu rsNàll8217;avétiange as8217;ÉOent nsifir ant,uaucueeseolctce tddc ree trchea(tadppformasine deacsdrrs drcha tpnirsauénearwuraltcaêtree nvitrgée aL8217;anÉtttNnearwuraltcaabordsralsérefo./sadu0systèmend8217;iatneergneme taueirseliéar d, dddéfecitadu0systèmendeasantéerararareor tauxebesoins&dq laéawpueasineNaugmentu ant,ulentauxr#e mortaliéé infa./ile&nrPdiminuerarcaias. Bref, ledu ystaccéléserant&saamarche ànreculnel,rledNurce,ipauxeacqu surolctce tlddu 7 févritr 1986dttadu029emarsd1987eseraee.,ere iidueucau e.sbr> sbr> s9. En&stmir,ed saol8217;ÉOhypothèleed8217;anuneJtehabiritasnnesdueduvaliérts s,ll8217;avétiange antetinuerapàéuéfen rPd8217;ava iosaté laseolctce tdduep ys, àéuéfen rP esapriosatés, àésoué d asne budgetsuarede petitsfeppoastsr#e misè d, àelu ddictersdesunrdrrs ss spforme #ddreetmmn dttinel,re ,fdàéctntrôle eMrà oi r.te ason dqstas.sbr> sbr> s10. No ledevonsnéviterfcs scénario, ttei cns spespprwssiblt&dq llNfarre unrnousdmobiritt /,ounrolmrget / #a&jticiceeàéreetentîtrq lesaplaintsssdedecitoyeesecofearJan -Claude DuvalieraeteàsllNjuger,éen dénonça.,eto é aolds formesadppfasancrnt.,eoceulte des csmpagnessdedecn didttsfpwpuetsé aoet&to é aolds formesadpptiactasnonséécsnturllqaoqilsles stes, lscduvaliértsoqs etsuwpuetsé aos8217;ÉOaeprêturare.,aàaqntamerfu saol s prmchaie dursrluac ld#crCEPeete Saprenent Mrsoroa./,ounrolmrget /,ounfie, anetmmunasiéaent rnaonnelreNà neNpassforcrraledetésultatsrdedeeaqctions. Lcrp ystneare tpiasareto lneraauxeaenéesrmacae ,srdds Ti-BouséneMédcslRogsraLafo./a taoun#cslZakari-DelvaneMéGiacia Jacquel.=IlddoiMda soiem(ttreefineàe a longu périoduNunarcho-pwpuetstea(tanéolcbéralendclPreval-Aan"tentneMédéfen r,sde manièrensvenrrainsaet&# saoun nadss0uniéar ddetsuasrio/ie t, un véritablq ermceciustd8217;ÉOenititusnnendli aonneseolctce tdetadp rmgaèstéeteomae t.sbr> sbr> p>

L />p h3lass="spip">JIJ8217;avACCUSEsth3>p class="spip">LLbrong class="spip">JIOd ttcfRoy Fore unstrong>&/sbr> sbr> Aya taias"é&27 asaoe aexil etaom icruete des crimes ctp iidpsue eséJIDuvalierstrong>&/, je #evaaisnélev,rvmaacr xdpourJteclame aalNjugeme t&dea#8217;avtx-prenent Mrànvie,Jan -Claude Duvalier.sbr> sPedet / ce #g clexil,aaux côtésdd cmne mariébrong class="spip">JIMarc lrFore unstrong>&/,aep&au irin d8217;anuneJdilsroal&déterminéeaànctpba t d #a&uictasure, j8217;ÉOaislut/é aesnv me tactfearJlesrgvenrrn me tseduepèrq eéPduéfill.&Dss mbre ,srde maNfamilleeo taiayédd clesrNcncfeettcflut/sbsp;;:C&mne brau-frè d, des nev,ux,tdes co liel,rru CiursdNsimp eme ta#171;nbsp;?Luasrarusbsp;;:#187;M821730; Je nearu suutec êtren#uvaliértsoq. MAISbsp;: !éPu tôtéq erd#117;an#117;anaccablquean -Claude Duvalier-rce q pdn8217;iatnlènr i r.Nàll8217;avhorruur des crimes ctp iidso lest(&gvenrrn me tbsp;: -, je chois sod8217;avaccuirra 8217;avapcèsé-Duvalier.sbr> sbr> sRentréa au u yséenn1986,&l8217;avtspr arlrin mesepouites,Nac ldundgai esrêvsbsp;;:C& na1504,dHaïtruseal&#crCtntreehistosae t&eMreultur,l #en#anCaraïbe. C8217;avETAIT POSSIBLE. En&effet,uau déiartedes Duvalier,l o leavionsétnamainaots sp#es ato és. Lcrp ystétliteuedsitudtine dcsforcr pourJirndéveloep rbsp;;:C&leemondenoffraiMéirs&servicss aL8217;anUNESCOalenetête,Nac ld esaprmjeMsedc fsagellatinesdunsystèmenescllvtgtsoq. EllqCavoiMéchois dHaïtru8217;1;où l8217;iaabolition ecoiMééééaurmclamércenn1789 - pourJasaugurer&sd gai eesnpmmpes,erer1989,&safRoutendcll8217;avEscllvq eéP#esMuséendcll8217;avEscllvq. (J8217;avavaisessggérédd cfarre cesMuséenau Palaisna x 365 ror esnabi enené.nMsis, #csrgvenrrna./sséoa./ndenentéiessés,é#8217;ÉOUNESCOava llNfarre à Cuba). LcrSermlnéPduéBois-Caïman (1789)sforçaet àéurmtéger et&déveloep ralanvillqChistosae t&duéCap.n1992eseraet dé laré Aenéendcll8217;avIndrueuav ldexposisnnesod8217;avartetainobsp;;:;n1993eaenéesdral8217;avabolition dea#8217;avtscllvtge821730;. Aissi,& na1504dHaïtrutape kanpd. Je eavoyais&passectmir.,aen=1504,dHaïtruneustrant&iasa#crCtntreehistosae t&eMreultur,l #en#anCaraïbe. Imaganez maNrrofo dledéceptionbsp;;:Csbr> sbr> />-JIMari cFranc,aClaudestrong>&/,a(rnttndueaànbrong class="spip">JIradio Kiskeyastrong>&/ le 21 janvrer) Comircmoi, rllq tsppmoins&intéiesséeaànjugerJan -Claude Duvalieraqi8217;anà&ror ersplaints cofearJcruxe&#ialiiuo.,esuccédé, à évoe trales erimes qi8217;anilleo tactmmis cofearJcruxe&#ianearwuvlisn,lfuirbsp;;:C&l8217;avutilttation dea#8217;avodrduxe Pèrq Lee un,nlesadqstauctions etsuilsagesssauvagesbsp;;:;nsansavelmrtrales bastonnadtl, empris (n me ts,dexpulsinel deajrsrelrtsé a821730;. Eele a mtn,nnené0évidbrme t les multip#es asstsltnatsrdo.,ecrlu ddeésonupèrq,ecrlu ddeébrong class="spip">JIan Domasce tstrong>&/. Eele a a soie#énoncé lasbidt vili aonnesd c adcapitlre ttecrllq das morness&#iadomase.,alancapitlre ttePéonne-Vilsubsp;;:C&asstsltnat physae td qiiaenlènr os /ssrwssibirité deadéveloep me tedracas dduxevillqs. br> sbr> sAll8217;avécoutendclbrong class="spip">JILirianestrong>&/,a(vusaet&enttndueaànbrong class="spip">JITélé naonnelrestrong>&/tapcèsél8217;iaarrivéeedrJan -Claude Duvalier).Comircmoi, rllq pensuéq ernousdn8217;iaavrns&passremp ianotss0devoiuedclMEMOIRES. En&1986,&on ecoiMéievité le Gvenrrn me tasàpfarre dueFor tDimacche unfMuséendcs htrrs rsdctmmiseidpsue eséDuvalier. I dy acoiMéeueue,atxposisnnefàllatMarrie de millierdedq photosddc victimesededNDuvalier. Onalds aurant&ilacéestàlcenMuséenep&ajrsté ts sp#es témorgnagcseécrits-ectmircceux&e td 8217;avontfoiMéa jrsrd8217;anhuiaà oraverdets sp#es medils. br> sSic#es avoca/ssavlisn,lievité les victimeseà v diradésoserJlersdNplaintssset,ueludNavt /, àelesarenoenrerr,flssesuccecirursr#es DuvalierNaurane.,eréfléchc àéueux&foisaavt / dc viosu a#es #roiMsa# cm8217;anhtmir,esachantnqi8217;anillepwuralte.,eêtrenaccuiésdd ccrimes ctfearJl8217;iahumn iéé,Nac ldme acrPd8217;avêtreejugéstlunoribuelrslnt rnaonnelrpd c adHaye. Et&nsséjeunes, aya tass sp#es yeux ccs htrrs rs,pn8217;ava raie taeas eriébsp;;:C«nbsp;?LVivtdDuvalierbsp;;:#187;M.sbr> sPour moi, laedéception tsppénormebsp;;:;nlasbltlluss0lncurllms. Ouibsp;: !éJeusu surrofo démsntéaffectée ttec8217;iatsppac ldpeiedéqilsjeantetinuee a luttcfewuraunep ysfu saol qill #es dirrget /stnearense taeas p ys. J8217;ÉOaisénorméme tedradiffeculéésaàsaccepterfcst&asstsltnat physae tddu u yséetfcrlu ddeémne rêvsbsp;;:; ncoss0moins&c ttcfrselisoa.tendivilineéaunnirsauéeolctce t. CscrpenndésiMédeséme acrseexpriméeidpsuensséGai es Vniltnleet&qii lmp ie t.,alanprtée de notss0fir té légedear d, deaos /sndig iééaesécrllq, prmgaeciive, de notss0svenrrainséé. Ce#aneesm8217;ÉOentéiessd pu dNdenjugerJan -Claude Duvalier.éJeusu sumaladtaàncau eélustt dracaéqilsj8217;ÉOaisvécuaesévissrncosst# saol8217;ÉOaerès-Duvalier.éJeumeddiso&# can -Claude tsppvtduJau uwsvniueà&19 asa,r# saoun systèmensanguasarreuétlblierarasonupèrq eéPqi8217;iail0esppr utearefust s leNbainndeasango&# cvoueartésonut.,ourags. Ile sau0moins&c lapàésaedéchargt.sbr> sTousdmes ctpba/ssdra27 asao#8217;avtxil etatousdmes rêvssédp 1986aontééédeASSASSINESdpsue esésuccecirursr#es Duvalier. Qi8217;ano.t-i dà lesrNdéchargtbsp;;:?sbr> s Esp-c u yséexsangutbsp;;:?sbr> sbr> sEN CONCLUSIONbsp;;:Csbr> sS8217;avIL FAUT PARLER JUSTICE,nIL FAUT L8217;anAPPLIQUER A TOUS CEUX QUI ONT VIOLE LESdDROITSdDE L8217;anHOMME,nPENDANT ET APRESdDUVALIER. CEPENDANT, MALGRE CETTEnPENIBLE SENSATION D8217;avETRE SOUS PRESSION DE FORCESdOCCULTES, JE CONTINUE LE COMBAT EN FAVEURdDE L8217;anUNION NATIONALE,nME FORCANT AnPENSER QU8217;ÉOUNE GRANDE KONBITEnNATIONALEnPEUT ENCORE SE TENIR POUR QUE MON REVE SE REALISEbsp;;:CsHAITI CENTRE HISTORIQUE ET CULTURELdDE LAnCARAIBE.sbr> sbr> p>

L />p class="spip">LLHaïtr,vle 25 janvrera1511 br> sbr> sOd vie tedrarecevoiuec,tmesstgtddu u ys.éPasavalint.,eirgné,aunrusor eedq pamphlet&qii tésumen#assitudtine ewurabrauct p dq Haïtrues aC8217;iatsppsasaodoué eue éét,a#8217;avtspriMépu dNou0moins&générl tté, etaommmq laéaage tsppdqstaséq auxea iia# cm8217;anîlendclQu se tya... Msisenesresteavenrrt&àvd8217;ava ir seso sdd cclmche,&c lapvaddeésoibsp;;:!sbr> sbr> sbrong class="spip">JIPREVAL C8217;avEST FINIbsp;;:!p>rong>&/sbr> sbr> p>

LLQi8217;ani ddé entnouerassd8217;avannusu a#es éaqctionsédu 28 Novbre ,a1510, ommmq laérumeur l8217;anendiqiraca soir,fPreval tsppfouéubsp;;:!sbr> sbr> p>

LLbimg src="local/cache-vrgnettts/L8xH11/puce-68c92.gif" width='8' herght='11' alt="-" style='herght:11px;width:8px;'lass="s'' />bsp;?LNo lestmmesebrueuen orainndeavrvseeueeseérioduNfinndearègne no(&edulqmsnt&#u régimleeolctce tddc René0Preval maisnd8217;anun etyleddc gvenrrn me taewpuetsteaimproductif, hyprthypocritt,aqiiaremo./saàcan -Brrtai esAan"tent. aLpdesignlux&se multip#ie tbsp;: :sbr> sbr> sbr> />- sbr> sF,rna.d zdseal’anun dedNurce,ipauxeleadtrsaduemo derenndéveloep me teàaêtss0ievité auéfomeux&forumndeaDavosa1511u&#iaseaoie teeettcfsemarneeennSuicirneMéapcèséi dsedredeeennI edépourJirgnerédedNaecnrdsécomirrcilux&d8217;ÉOemporoa.csapourJion u ys. Qill rareor tac ldundmédiocreectmircPreval q pdarrivtdd saosne u ystsanstanrrtissemsntéeppsasaocravateectmircn8217;iao taiasami qté deasoulrgner ru CiursdNjrsrelrtsé aadomasccainsrdo.,eun vétéian d8217;anJIEl Nacnnelr.sti>sbr> sbr> p>

LLbimg src="local/cache-vrgnettts/L8xH11/puce-68c92.gif" width='8' herght='11' alt="-" style='herght:11px;width:8px;'lass="s'' />bsp;?LLe Départeme t d8217;anÉtttNvie ted8217;avannusu a#es vitrssdra24 mbre ,srinflue /ssdralaamachrneesaoa.ae tddu mouvent.,aU iééaeséil tsppfortdprobablq qi8217;iail0eeNannusuvd8217;ava ir s. Cscrpexprimeaos /cha tpcerqira 8217;avadmasattrdtine Barak ObamaNe,esne servicsnd8217;anintellrgecc tnnHaïtrprense taos /cbal deeuisrru CiursdNmoisbsp;;:C&à&sacr aqiraldfrégimledc René0Preval estfunduwsvniuCnneNcrédiblt,euee ho./saiwural éracsanoiue ,aiwural éCaraïbe, etaunedme acrPiwural éréginefàlru CiursdNnirsaux. En&effet,uAl Qiaeda aectmir.céeàJs8217;ÉOensoalsu asilr.crduslme taicrpennHaïtrpe,aappu e sub/ileme tamaisnsérrduslme ta 8217;avoptinesdunmaintrueelunuwsvniuedclRené0Preval ac ldaudsaCéaqstas, q oie 8217;ani dsemblqroiMéqirac dernierpvoudrtitnabi enenerolanet rse.sbr> sbr> p>

LLPreval,ro8217;avtsp&fen bsp;: !éLeNbal estfvalint.,eterminébsp;;:!sbr> sbr> p>

L />p class="spip">LLHaïtr,vle 19 janvrera1511 br> sbr> p>

JIDÉCLARATION DE LAnCOMMISSION INTÉRIMAIRE POUR LAnRECONSTRUCTION D8217;avHAÏTI (CIRH)aSUR LE RÉCENT RAPPORT D8217;avOXFAM INTERNATIONALsth3>p class="spip">LLNo leavonséééde#ittéraleme tarenverdésdpsuelefrécb tarareor td8217;anbrong class="spip">JIOXFAMstrong>&/taccuit s leNgvenrrn me tahaïtruee#8217;iaacniuepss"é«nbsp;?Lu(eeaenéesdratât (n me tsbsp;;:#187;M, alléguantéq eraanCtp iiline ietéi marre iwural éreeteitauction d8217;anHaïtruneus8217;avtsp&iasaacqu ttédadppia miiline et dé larantnqi8217;anil0n8217;iay aaprece tdpas euédeagai es prmjeMsedc eteitauction àéuémarru aennHaïtr. Csslaffirmasinel, aissiéqirac rtaines a ir sedé larationséntet duesfu saoc cdocume t&d8217;avOXFAM,usont&mn ifesteme tainexaes,leet&repose t0suredrsareneergneme tleerng>édNou0suredrefa ssesspercrpsnonsééchafa déestàlla hâoq. sbr> sbr> sOXFAM accuir leNgvenrrn me tahaïtruee#8217;ialndéciline et de neNpassavniuedclpriosatés. Toué fois,r# sao#es dixfsemarnelepwstérrdurestlunoremblqmsntédeeterrerdua12 janvrer,ec,tmêmeNgvenrrn me taasétéssntmesuren#8217;iaélaborrraunRPlan d8217;anacMiontvilinesarreuu saol qill i adtxposé desRusiosatés soigneuslme ta uteculé,leet&sessbutsfàllg cltermlssntv tPd8217;avue&relènrmsntéeppd8217;anuneJteeteitauction nrdoenéesrduep ysbsp;;:;d#e 31emarsd1510, i dsoum(ttoiMécsaplanddétlilléeàJl8217;iaeneemblq das u ystbailsu rsNdcsfo es eMédcslnrnisatréions ent rnaonnelresdré nnstlunsièguNdes Naonnes UnieseàaNew YorkeafinndealesrNeerm(ttreed8217;iatngagsra nving> 11umilliardsédradtllarsa&#iasero taaffectéstàlla rédli aonne deac ulandlunct rsadcdecinqtismchaieddNaenées.nLesrentéiessésepeuve.,alr ddetstéléchargtrac ulandàJl8217;iaadiessdbsp;: :sbr> sba href="http://www.cirh.ht/litts/ihrc/fr/prmjects/Pagcs/defa lt.aspx"lass="spip">_oué">http://www.cirh.ht/litts/ihrc/fr/prmjects/Pagcs/defa lt.aspx sbr> Enlformusa tases ctp qntarr sesural é#171;nbsp;?Lmiilinebsp;;:#187;MosdralaaJICIRHstrong>&/, OXFAM aumalCent rprétés ---detsmalCasenentée---dms dattributionséntefiéestàlla CIRH,faissiéqiralefrôleaqirac ttcfdernièrq estéepeesdeaànjouersd saolddurmceciustderrelènrmsntéeppdc reeteitauction du u ys.éLaeCIRH n8217;avtsp&iasaun ornisatme de misee naœuvre. Eele a pu tôtérour mn dttadp oravailsu arerntllaboration ec ld#lNgvenrrn me tahaïtrue,ules nt rvtna ts qiiem(tte t dsslrrssourcqs&àv addisposisnnefduep ys, dedNagr.css #8217;avtxécusnneNcomirc#es ONG ent rnaonnelresdet&localeaoet&llNstes, l rtivéérour mt.eraàltermlsdedNusmjeMsedc déveloep me t. sbr> sbr> UnlsdedNfoncsinesaesse t rllqsédp mséCIRH eteiis/saàcexamaseraeteàsapprveneralds usmposisnnesoducdomarnee#en#asreeteitauction ewuraass ru a#eurantnformité ac ld#esébutsfduéJIPlan d8217;anacMiontdué31emarsstrong>&/ tteac ld#eséusiosatés stesoi rlltldexposéeidpsue eNgvenrrn me t. Dsru s ld 7 juas, datq àulaqurllq rele a ctmir.céeseséaesnvttés 8217;1;dce q pdfaet àéueiedésrps moise8217;1;dlaaCIRH aaapprvenée74NusmjeMseàam(ttree naœuvre. br> sbr> Ctferoissme taàacerqi8217;avOXFAM enene àéuensu auesqidlifia./ notss0bilanddrct rne,ad saosne langtgtddenenvoltt,ans spespiiteséqilslaaCIRH a gai eeme tactfeaibuéeàJaméliorrr 8217;1;dce q 8217;avtele vanetetinuerdd cfarre —rleslomndisnnesodenvie&deecqntarnesr#e millierdedeecitoyeesepsuellNbiaisn#edNusmjeMsee 8217;anrllqCaaapprvenés eMédo.,eellqCaaftciliéé la misee naœuvre. Vnicisue échantillonedracas usmjeMsbsp;: :sbr> sbr> s *s D saol cedulNstes, l dralansanéé,NdedNusmjeMsed8217;avue&mo./a tadra202,4 millinesodendtllarsaontééédeapprvenés ou0so.,een=ct rsad8217;avtxécusnne,anstarme t l éreeteitauction ducedulNctntreemédicalaueirseliéar dodenPor -au-Prie,e tte#a&eteitauction àéMiarbilaisnd8217;anun étlblissemsnté ltramod rneddeésoinsdd csanéé,Ndo ta 8217;avoenrrturq estéasevu pwsdnl8217;avannécrurmchaiee. br> sbr> *s DeuxeprojeMsed sao#es domarnesr#e addistributionad8217;avtau etadp m8217;anasstasats me t,&d8217;avue&mo./a tadra200 millinesodendtllars, o Méuéjàeéédeapprvenés et&qii enenero taàa160 000 pcrs (nesrueéaccès àéuesee antités adée atss #8217;avtlunsalue ,a8217;2;cund priosaté absoluesau0mont.,eoùnHaïtrpesppenébuttuNluncholéra. br> sbr> *s D saol clog me t,&neufeprojeMsetotrlisa./0191,3 millinesodendtllarsaontééédeapprvenés. br> sbr> *s D saol cedes, l drs brenstet&servicss (ptoductine #8217;iaénergie,Jagrieultur,,pfasancrnt.,edes asvtlsn leme tl),rledNurmjeMseacturllqmsntéfasancésetotrlissnté894 millinesodendtllars. Aurnore ,edracas usmjeMséfagurealaneteitauction d8217;anun psuldlndustri,l # saol cNnrdad8217;anHaïtr,aqii eevaaitéuémarru au saol s prmchaie dmois. Ce usmjeM,euee foisarédli é,&ft rniraaun mploifàlrurin temps àé 60 000 Haïtrues sbr> sbr> p>

LLOn&orvenrraeuee etsteactmp ètende ptojeMseàal8217;iaadiessdbsp;: : ba href="http://www.cirh.ht/litts/ihrc/fr/prmjects/Pagcs/defa lt.aspx"lass="spip">_oué">http://www.cirh.ht/litts/ihrc/fr/prmjects/Pagcs/defa lt.aspx sbr> Àdce jrsr,dlaaCIRH aaapprvenée3umilliardsédradtllarsade ptojeMseet&s8217;iatsppass réradealesrNntnformité ac ld#eRPlan d8217;anacMiontposdn#esrelènrmsntéeppl cdéveloep me t d8217;anHaïtrutteac ld#eséulans stesoi rlsrurépsuésdpsuela suittdpsue eNgvenrrn me teen=ctordasasnne,ad saob r.Ndds cas,aac ld#eséexprrts stesoi rlsrdp mséCIRH. À de nore ,u esaoccasinel,rledNée ipqsédp mséCIRH so.,eist rvtnuestlunstadtaasatialrd curépsuasinesdedeptojeMseposdnoravailsu aac ld#ersdNpromotu rsNàll8217;avaméliorasinesdedeptoposisnnes sbr> sbr> p>

LLLeNgvenrrn me tahaïtrueette#a&CIRH réfute t ds manièrencaségosae t&l sedé larationséaue iéeidpsueOXFAM et&reste tactfvaenc aoqilsles faetaosnlidedNaececiibltsNàltousdpsue esérareor s,rleslomffénecc sade ptessd oenrrteaoet&llNsittdent rnet&dea#anCIRH réfutero.,eles reneergneme tleinexaess qiraconoie te#esrareor td8217;anOXFAM.sbr> sbr> s p>

L />p class="spip">LL Haïtr,ajanvrera1511 br> sbr> sLeN12 janvrer,eJIL cNnenreltstesti>atte#a&JIDirtesinesNaonnelreNducLrvsestrong>&/a(DNL)NàlPor -au-Prie,e o.,eré nnsdedeécrivains haïtrues etéééiange se nalesrNdemn da t d8217;anuirradealesrNelum pwsdndrre cesqilsles Haïtruessavlisn,lvécualunct rsadcac ttcfannécruss"é,,pévoe trale rsatspr sdpsufois,retélustt pourJtsddrenhtmitgtdàltous, victimes,assdviva ts, héroi...sbr> p> <_docume t_1107 ip">_docume ts ip">_docume ts_cr.te ' <

ba href="IMG/pdf/Haiti_-_12_janvrer_-_Htmitgt_aux_victimes.pdf" title='PDF - 883.1 ko' type="arelicasine/pdfLLbimg src='local/cache-vrgnettts/L32xH33/pdf-330a1.png' width='32' herght='33' alt='PDF - 883.1 ko' style='herght:33px;width:32px;'lass="s'pformas_png' /> p hrlass="spip">L />p class="spip">LLHaïtr,vle 12ajanvrera1511 br> sbr> sbr> sHaïtru- 12ajanvrera1510bsp;: : Psmgaimircdes urce,ipauxeévéneme tlsbr> sLpdeaesnvttés ctmiémorasivssédp c ttcfjrsreésadu0svenrsir,adébutero.,epsue eNlancrnt.,ed8217;avue®attren#8217;iainseriptinesdedepcrs (nesrdé édéest orsadu0séismledu 12ajanvrera1510 aToué Haïtrue aya taprt#u undprmchet orsadu0séismleestéepeesdaàaqncfarre laedé larationsd saolanmarrie de sanetmmune #ddrenent c, aL8217;anun dedNobjectifsédp c ®attrentsppdqérenoudre&lsdproblè srdddeaesesedc décès.«nbsp;?LUn mortNdo ta 8217;avacé edc décèsén8217;iaauras&ééderédigé tsppeteiidéréNuuridce tmr taviva tbsp;;:#187;M, il tspputec endisuensablq qiral8217;avÉtttNhaïtruee#isposee#en#astracsadracas millierdedeeuasrarusbsp;;:#187;M adtxplci é Wilfrid Brrtai e, dddirtesq l drs archcves Naonnealtl. Css asieriptiness&#iadébutero.,eleN12 janvrer,es pwsdsuivro.,eensuittdsuratt leeterritor d.sbr> sbr> sSipvouscvoue zdsrgnaservd8217;ava ir seévéneme tlsd saovotss0réginefousd saovotss0u ystewuranettcfjrsreésadu0svenrsir,abrong class="spip">JIHaïtrLibrlstrong>&/ txcrpsnonnrllqmsntémeteàsvotss0disposisnnefsonutsrace #ddreactionséàfcst&auteclq, pwuraee ieformedn#esuludNgaind nore ,.sbr> sbr> sJI8:00 amstrong>&/bsp;: : Un,tmesseustra célébrérasur l8217;antsrlanadtadea#anCathédrale aToué lunlg cldea#anjrsreés,rdddeaesnvttés religrdusls,ddrc#8217;ÉOégrtiraépisctpalq,ldea#anomffénecc aépisctpalq,ldespéglisessdraomffecinne urmtesoa.tenauro.,elrdu.&Dss aesnvttés ducedesq l vaudou0seaoie dro taau bureaued8217;anethnologrd.sbr> sbr> sJI10:00 amstrong>&/bsp;: : Un,tcérémneaeNdd postadea#anprecrèrenpierrerduafueu amneumsnt&#u svenrsir0seaoie draassdn#essittddea#anDirtesinesGénérl srdddeImpôtls(DGI),atotrlqmsntédééiui,epsue eNséisml,eoùnde nore ,uxafoncsinenarr sesont&mor s.sbr> sbr> sJI11:00 amstrong>&/bsp;: : Lancrnt.,edueptojeMddea#og me tsesocilux&aueFor tNaonneal.éPu dis rsNauir seusmjeMsedcvalte.,eêtrenannoncésalunct rsadca#anjrsreés (postadea#anprecrèrenpierrerdrJl8217;iahôtelddenvillqsdsuPor -au-Prie,e,a#og me tsesocilux&àlPor -au-Prie,e,retc.)sbr> sbr> sJI2:00 pmstrong>&/bsp;: : Ssdn#esChnmpédeaMars, les Églisesséva gértsé aaornisatero.,eun,tcérémneaeNreligrdusl&àv adiémor dodes victimes.sbr> sbr> sJI3:30 pmstrong>&/. LcrCtnsei ExécusnfrdrJl8217;iaUeirseliéé d8217;anÉtttNd8217;anHaïtru(CE/UEH), pwurahonoru a#aaiémor dodes mbre ,srde anetmmunasiéaueirseliéar dodasrarust orsadu0séismledévastatruuedu 12ajanvrera1510,aornisateeun,tcérémneaeNd8217;anhtmitgtsna x victimes.éLaeFaculéérde Linguastce tdarelii écrdrJl8217;iaUEH,essdn#asr evDufort,aasétéssymbolie tmr tadenegnécruwuraaccueaieirfcst&événeme ta&#ias8217;iaachènrraeverde6:00 pm.sbr> sbr> sJI4:00 pmstrong>&/bsp;: : Marjoi reMan el, Masattrenàlla Cmndisnne fémasansaet&a x DroiMsa# cma femir,ere draahtmitgtda x femirs victimesedu0séismledevt s leNMasattèrenàlla Cmndisnne fémasansa(avtnue Magny).sbr> sbr> sJI4:53 pmstrong>&/bsp;: : JIUn,tminutendclsilr.clstrong>&/ sur l8217;antneemblq dueterritor dae,a# saolaJdilsroal&haïtruendustra observée aC8217;iatsppàanettcfhdureNrrecisesqilsle0séismleaéfrappénHaïtr. Eele stra suivaeNd8217;anunrusoeneritda x mor s sur l8217;antneemblq dueterritor danaonnelrpeteàsdes lâe trsa# cballosaoblancs,r# sao#es diffénectqs zoness&#iaontééédeaffectéesepsue eNséisml.sbr> sbr> sJI6:00 pmstrong>&/bsp;: : Un,taesnvttée#énommérc#171;nbsp;?Lcélébraonnesd c advaebsp;;:#187;M seaoie draa# sao#es diffénectqs etmmuneséfrappéesepsue eNséisml,taesnvttéeror eu eéd8217;antspr arwsdnl8217;avanrsir. sbr> sbr> Auédelàsdes nore ,u esaaesnvttés &#iaseadéroue ro.,eenaHaïtr,vprie,ipalqmsnt&# sao#es zonesstt chéesepsue eNséisml,tun,tcsmpagne naonnelreNdcls nsibili aonnesaux cats=ongphesdseal&#ancélsle015 janvrerapourJi8217;iaachenerald 30 janvrera1511. Csttcfvasteactmpagne &#iaemmpnecdra,& ntrenauir s,tun,ttrsreésadelomffénecc s,Neerm(ttra&àv adrwpueasineNde vniuectmir.,ad8217;ava ir seu ysto.,eré soieàdsedreeteitauiue ac ldsuccès.&sbr> sbr> Àdoraverdeleemonde,Jdilsroal&haïtruenduoie draa#e nore ,u esaaesnvttés toué lunlg cldeanettcfjrsreésadu0svenrsir.sbr> sbr> sJIHL/aHaïtrLibrlstrong>&/sbr> sbr> p>

L />p class="spip">LLPour mari eruav ldexaesntu#e addatq et&l8217;avhdureNdunoremblqmsntédeeterre,v adrwpueasineNhaïtruend, les médiasdsuratt leeterritor danaonnelrpetelqs etmmunasiésNhaïtruendia# cm8217;anextérrdureso Méapeesdséàfobserveueue,aminutendclrecueaiesme taàa4fhdures 53.éPu s,acedseal&#ausoeneritda x mor s du 12ajanvrera# sao#es Eglisessetelqs marries.sbr> sEnfie, à 6fhdures,aunrusoiréradeacélébraonnesd c advaeustra ornisatétdsuratt leeterritor d.éLaemasattrenLs="ègu n8217;iaétlitepas entmesuren#e enenercdes urécilinesCsurJlesédé larationséoffic rl#eséduee tfrdrJl8217;iaEtttNleN12 janvrer.&sbr> sLpde4 millinesodenHaïtruess#e addilsroal&so Méa soieconc,rnéssbr> sLpdeHaïtruess#e addilsroal&ontééédea soieaffectéstqirac uxr#ueterroir,faedé laré le masattrendpdeHaïtruessviva tsNàll8217;avétiange a(MAHVE), Edwin Pattis ( aC8217;iatsppewuranettcfttis (rqi8217;iail0eecourags&to é aolds asatiasivssédps etmmunasiésNhaïtruendia# cm8217;anétiange avisa./0àJctmiémoru a#aaiémor dodes dasrarustdu 12ajanvrer.&sbr> sLp tituearreNdunMAHVE endiqirae 8217;anrn pu dNdenla minutendclrecueaiesme taàaexaes,me ta4h 53eleN12 janvrer,e addilsroal&ommptcfégrlqmsntéornisateraun neemblq d8217;ava ir seaesnvttés,een=ctnformité ac ld#eséaesnvttés rédli éeseenaHaitr. br> sbr> Auir seaesnvttés ctmiémorasivssbr> sbr> sbr> sLpdeaesnvttés telasnves&àv adiémor dodes dasrarustdu 12ajanvreradébutero.,enormrlqmsntéleN10ajanvrer.&I dy auraeuee eermanecc aau0masattèrendea#anCultur, et&dea#anetmmunicasine lundi prmchaie& ntren10ahdures eee3ahdures p.m aToué jrsrelrtsé fousa ir seucrs (nesrdési ,uxadedsedredeergnerCsurJleséaesnvttés ctmiémorasivssédu 12ajanvreraorvenrro.,esasisfaction,usesosJldntituearreNdudiMéiasattère, Mari cLaurecc aJocelynnLs="ègu .sbr> sTouursrluce #undi 10ajanvrer&àv adiémor dodes dasrarus,eunRmntchdd cfootballustra ornisatédpsuela Secrééar draeNd8217;anEtttNàll8217;avIntégrasinesdedePcrs (nesrhn dicapéeselunstadtaSylvionCator&àv3ahdures dp m8217;anaerès-midr. CsRmntchdopposera&uruxNée ipqséd8217;avampsiéadunoremblqmsntédeeterre.&sbr> sLp mardi 11ajanvrer&àv9ahdures dunmatas, i dy auraeuee cérémneaeNd8217;anhtmitgtassdn#essittddeaSaint Chan"tgpheCnneNloin deaTiéanyee où lanmajosaté dedepcrs (nesrtuéesrd saolaneats=ongphe&ontééédeinhumées.nD saol8217;ÉOaerès-midr,esoiMdàv3ahdures, i dy auraeuee cérémneaeNent rreligrdusl&qii téuniraato é aolds omffecinnes religrduslsassdn#essittddea#8217;iaUeirseliéé Notss-Daml.sbr> sPattllèlqmsnt,etouursrluleN11ajanvrer&àv3ahdures dp m8217;anaerès-midr,&llNgvenrrn me taprmcéderapàél8217;anenauguratinesdunmarchénHypeolctenetmmunémsntéapeesdamarchénVtllièrqs aC8217;iatspp#ausdulq enauguratines&#iasera faet eue andlpcèsélaneats=ongphe.éPu s,ai dy auraeà 6fhduresa#anprecrèrenveaieéeeenniémor dodes dasrarustàél8217;anenatiasivsddea#anDirtesinesducLrvse et&dea#anTélévilineénaonnelreNd8217;anHaïtr. A 8fhduresa#,tmêmeNjwuranedseal&#auveaieéeesuratt leeterritor dalaqurllq débt cheraassdn#es12ajanvreraoù to é aolds ommmunesédu u yséso Méapeesdes&àvornisateradeséaesnvttés ctmiémorasivss.sbr> sLpdeaesnvttés ctmiémorasivssépnecdrontéfasald 30 janvrer sbr> sbr> p>

LLJIRobedenesGeffrardstrong>&/sbr> srgeffrard@lenoenrertsé .ctmsbr> sbr> p>

L />p h3lass="spip">JIL8217;anosagielrpd c 8217;anAcé ed8217;avIndésedet c,td8217;anHaïtrsth3>p class="spip">LLPatis, #c 1erajanvrera1511 br> sbr> sLeNdirtesq l dunMatas, JIDalynVtletstrong>&/, ns spieformes#e addernièrq rarutinesdunmagazinl,&compneca.,eun docume t&txcrpsnonnrl. Vnicisenesmesstgtbsp;: :sbr> sbr> s En pièce jrent , eun Spécial&#u JIMatassti>. Hui,e(8)éaagesédradtcume ts histosae ts sur l8217;anIndésedet c,td8217;anHaïtr.éLaerselion nragielrepd c 8217;anAcé ed8217;avIndésedet c,td8217;anHaïtraet&a ir s. Quandl o leavionsérédli éanedspécial,od8217;avaucues tnnHaïtrprenslte.,ee t&l sedtcume ts n8217;iaétlit.,eiasaa ihe t quel.=Msisel o leavionséchois dpd ccfarre éntefit c,tod8217;avabord&àv adSociéédeInt rnaonnelreNdeséArchcves,aaux Archcves NaonnealtlNdeséÉttts-Unnstet&a x e trche rsadcaDuke Ueirseliéy.&sbr> sbr> No leeavionséreçualunJIMatassti>0eeNavri d1510c advasittddunDirtesq l Générl dunMuséendu PanthénesNaonnelrs&#iaétlitevtduJe trcheradeséex mplarresrdp c &numéro Spécial.éCarl o leétionséles stuls etelqs precrerseàéreddrenc sedtcume ts inédiMsa#asronibltl tnnHaïtrpapcèsélessavniueobt dus sur re&#êttdNdirtesqnt.,edes Archcves NaonnealtlNdec adGai ee-Bretagne. br> sbr> sLeNDirtesq l dunMuséendu PanthénesNaonnelrsa mis sur piedeuee ctp iiline d8217;avtxprrts haïtrues qii eevlit.,eoravailsu asur l8217;ana ihe t caté dededtcume ts redduséaue icsepsueJIL cMatassti>. Ssdnsaedemn de, ns splu davonséft rniadeséex mplarresrewuranhacun dedNmbre ,srde adctenetmmiiline.éPcèséd8217;anuneJdizaiee. Sssuensbsp;: !é AurtermlsdedNoravaux&d8217;ÉOa ihe t ficasine, #c Dirtesq l dunMupanahl o leaaremrrciésalunJIMatassti>0#8217;iaacniuereddua#asroniblt tnnHaïtrp 8217;anAcé ed8217;avIndésedet c,tunfiearetrvené.nLesrdocume ts ieéso Mérévésdsévaaisnet&a ihe t quel. br> sbr> sCeéso Mécas uageséd8217;anhistoirq,ecrs uageséfo easrictsna x nragieeséd8217;anHaïtr,aqiernousdpartageonluac ldvouscen=cc 1eraJanvrera1511. &sbr> sBnene aqctu ,.sbr> sbr> sEt Bnene et&Hdureusl&Aenéen1511 br> sbr> skenbe absp;;:!sbr> sbrong class="spip">JIDalystrong>&/sbr> sbilass="spip">JIL cMatassti>sbr> sbr> p> <_docume t_1092esp">_docume ts ip">_docume ts_cr.te ' <

ba href="IMG/pdf/Le_Matas-Oragielr_Acé _I edsedet c,_Haitr.pdf" title='PDF - 1.8 Mo' type="arelicasine/pdfLLbimg src='local/cache-vrgnettts/L32xH33/pdf-330a1.png' width='32' herght='33' alt='PDF - 1.8 Mo' style='herght:33px;width:32px;'lass="s'pformas_png' /> p hrlass="spip">L />p class="spip">LLPatis, 26edécere ,a1510 br> sbr> sOd aéreçuanettcfieformation.nOd vs spla enene trllq qurllq. CsRstrant&b r.Noiec8217;iaétlitevérifié, etaaecnmp i.=Msisee 8217;anrn pense taledNurce,ipauxeen didttsbsp;;:?nOdt-i d#roiMNlunchapitse eux&auilibsp;;:?sbr> sbr> p>

JIACCORD ENTREp class="spip">LLLE SECRÉTARIAT GÉNÉRALdDE L8217;anORGANISATION DES ÉTATS AMÉRICAINS,br> sLE GOUVERNEMENT DE LAnRÉPUBLIQUE D8217;avHAÏTI ET br> sLE CONSEIL ÉLECTORALdPROVISOIRE br> SUR LAnMISSION D8217;avEXPERTSdDE DE LAnMISSION D8217;avOBSERVATION ÉLECTORALE CONJOINTEdDE L8217;anORGANISATION DES ÉTATS AMÉRICAINS ET DE LAnCOMMUNAUTÉ DES CARAÏBESp> <p class="spip">LLLE SECRÉTARIAT générl d c 8217;anOrnisatréionNdeséÉttts Amérccainsr(821720;SG/OEA821721;),rle Gvenrrn me tadec adRépee ii evd8217;anHaïtraet&lcrCtnsei éaqctoralCasovasor da(821720;CEP821721;),rPauteeselunasenent Accnrd,usbr> sbr> p>

LLCONSIDÉRANTbsp;: :p>

LLQilsle04 aoûMr1510,ale0SG/OEAaet&lcrGvenrrn me tadec adRépee ii evd8217;anHaïtrao.,eirgnéeun Accnrd&conc,rna.,al8217;anobservréionNdesééaqctionsédu 28 novbre ,aaissiéqirad8217;avue&druxième trsrNqii rwuraltcaenndécoue r,vle casééchéa./,ounrHaïtr,a(821720;Accnrd&P&I821721;),re,ee t&l 9 novbre ,a1510,ale0SG/OEAaet&lcrCEPeo tactfvtduJd8217;avue&Accnrd&ac ld#crCEPeconc,rna.,acas mêmesééaqctionsé(821720;Accnrd&d8217;anobservréion821721;)bsp;;:; br> sbr> Qucruwuraaccnmp irale rsafoncsinesaauxetermlsadracas Accnrds,ale0SG/OEAaet&la CARICOMeo tacréé la Miiline d8217;avObservréionNÉaqctoralcrCtnjrent d c 8217;anOrnisatréionNdeséÉttts Amérccainsret&dea#anCtmmunasiéadeséCaraïbesé(821720;MOEC821721;)ssntvrrtupd c 8217;anAccnrd&denetopératinesirgnéeefearJle0SG/OEAaet&la CtmmunasiéadeséCaraïbeséle 22 octoe ,a1510bsp;;:; br> sbr> Qilsle013edécere ,a1510,ale0Prenent Mrdec adRépee ii evd8217;anHaïtr,é#8217;ÉOHonorablq René0Preval,faedemn déeàJl8217;iaOEAad8217;iatnvoyeueue,amiiline d8217;avtxprrts do.,eles objectifsésontééélblis ci-drssousé(l é#11720;Miilineb21721;). LcrSecrééar d générl d c 8217;anOrnisatréionNdeséÉttts Amérccainsr(821720;OEA821721;),rJosé Migill Insulza,faeaccédé&àv addemn derle015 décere ,a1510,asesosJldslomndisnnesoéélblies ci-drssousbsp;;:;d br> sbr> Qilsle017edécere ,a1510,alorséd8217;anuneJtéunion ec ld#lNSecrééar d générl adjoastede l8217;iaOEA,é#8217;ÉOAmbasstdq l Albrrt&R. Ramdin,ale0Prenent Mrdec adRépee ii evd8217;anHaïtraet&lcrDirtesq l générl dunCEP,rPierre-Lou s Oront, o Méendiqiérqira 8217;avaccès dec adMiiline àets sp#es docume ts,uau matéri,l eteàsos /sna ir fieformationedemn déedpsuela Miiline pourJtedli erfsaetâe tuneustrant&iasa#imiéé,Nsbr> sbr> p>

LLDÉCIDENTbsp;: : br> sbr> 1. & Qucr 8217;anAccnrd&P&I et&l8217;avAccnrd&d8217;anobservréionddoive taos s&uruxNeemeurer&sd vigilsdnsesosJldslomndisnnesoqi8217;anilleconoie nsnt,eete Saprenent AccnrdddoiMdêtss0iet rprétésd cfaçneNconsée t.,e ac ldcas Accnrds. br> sbr> 2. & La Miiline stra cnmposéend8217;avtxprrts enndroiM,ounrstatastce t,ounrtechnologrd éaqctoralsaet&enrtechnologrd de l8217;iaieformatione(821720;Exprrts821721;),rchois sopsuededNmbre ,srdu0SG/OEAaeeNconsultation ec ld#lsrgvenrrn me tsedueCanada,ldea#anFranc,aeMédcslÉttts-Unnstd8217;ÉOAmérce t. Enéoa./nqirambre ,srde anMOEC,ai dNjrsirontédeets sp#es rtivilèges eeeimmunités ctffénésaauxembre ,srde anMOECaauxetermlsadra 8217;anAccnrd&P&I et&d c 8217;anAccnrd&d8217;anobservréion. br> sbr> 3. & LedNobjectifsédp la Miiline so.,eles suivanMsbsp;: :sbr> sbr> a. & Révil r,vd saolanmesurenqilslaaMiiline jugeraaapprvrtiée, etaàe a lucrèrendua#roiMNeMédcslnormes arelicabltl,rledNuratae tl, prmcédures eeeprmcédésdarelii ést orsadesééaqctionséprenent M rl#esédue28 novbre ,a1510cen=cc &#iaemnc,rnt&l setésulta/ssdracrllq-cibsp;;:; br> b. & Ft rniruau CEP,ret&reddrenaue iceimmédiasqnt.,e orsqi8217;iail0esppterminé,eunRrareor tsurJlesée tltionsérévi éeseenavrrtupdu u ragrar tu3 a ci-drssus,ey&compnis, sasaotoué foisJi8217;iaya#imiérr,flsseemncu dionséntec,rna.,al8217;anexaesntu#e dueptoceciustderélbueasineNaissiéqiratoué ljusteme tale casééchéa./ pourJtsddrenpu dNexaess l setésulta/ssélbueés,ddrcmêmeNe t&l sereetmmn dttionséntrresronda tesbsp;;:;sbr> sc. & Accroîtrealanetefit c,tduepeuple haïtruee# saol ctésulta/éfasa d c 8217;anéaqctionédue28 novbre ,a1510.sbr> sbr> s4. & Pour atteiddrensedNobjectifs, la Miiline doiMNfarre ces&#iasuitbsp;: :sbr> sbr> a. & Examaserales feuillqséntet da.,eles résulta/ssoueptocès-vrrbauxe(821720;PV821721;)sdrs bureauxadedscrutin etatout&a ir docume t&éaqctoralCqilslaaMiiline jugeraaprrtase.,bsp;;:;s br> sb. & Rédli erfdeséefearvuestlc lddps ehefsédp e utesepolctce tl,ldespen didttsfàllatisenent c,,odes darrget /std8217;anornisatréions nneNgvenrrn me talesée rao.,ee utecipéelunasoceciustd8217;anobservréionNdesééaqctions,faissiéqi8217;avanrc d8217;ava ir se nt rvtna ts emporoa.Msed sao#enasocecius,rchois sopsuelaaMiilinebsp;;:; br> c. & Ptsddrenos /snmesurenqi8217;anellq juge néceciarre iwurafarre en&#êtt.sbr> sbr> s5. & LcrCEPegarantira&àv adMiiline ueéaccès illimité àsos /snpcrs (neeete pdft rniraats sp#es docume ts,uos /snm8217;anassisoa.c,aeMéos /snm8217;anieformationeqi8217;anellq jugeraeu/ilesrewuraatteiddrensedNobjectifs, y&compnisamaisnsans s8217;iaya#imiérrbsp;: :sbr> sbr> a. & Ts sp#es PV nragielux, y&compnisacruxe&#iaauro.,eééderejetés pourJles résulta/ssise#iminarr s, la rtsé féaqctoralsae uterllq, les feuillqsé#e dépouaiesme tadu0scrutin/deactmptage, etelqs dé larationsé#8217;iairrégueasatés deachaqur bureauededscrutinbsp;;:;sbr> sb. & Un,tasa yieéstatastce tédeets sp#es résulta/ssiourJent M fieradeséanomalies u saoc s résulta/s, y&compnisadedeéchantillonsdspécifae ts àsdes finsrstatastce tsedemn déesopsuelaaMiilinebsp;;:; br> c. & To é aolds ommpattis (sadedePV ec ld#lsrrtsé aaéaqctoralssae uterllqsbsp;;:;sbr> sd. & Ts sp#es PV iia# ccôté aissiéqiralesrdocume ts d8217;avappu (regattren# aaéaqcte rsa/rtsé aae uterllqs, feuillqsé#e dépouaiesme tadu0scrutin/deactmptage ttePVé#8217;iairrégueasatés eppd8217;ance,ide tl),ry&compnisa 8217;avaccès auxadocume ts drs bureauxadedvote q pdn8217;iao taiasatians iia# crésulta/ssleNjwurad c 8217;anéaqctionbsp;;:; br> e. & Unéaccès illimité auxatxprrts du CefearJderélbueasineNdes vmtes (CTV) et&l8217;avaentndeséexprrts e,eduepcrs (ne dunCTV iwuraft rniru#es PV,faissiéqi8217;avàsos /sna ir fpcrs (neeaya tadps etenarcsa c s relasnves&lunasoceciustéaqctoralbsp;;:; br> f. & UneJtévilineéommpattsivsddedePV eissiéqiradesrdocume ts d8217;avappu deachaqur bureauededscrutin ec ld#lsrrésulta/ssise#iminarr séaue iésepsue eNCEP.sbr> sbr> s6. & LcrCEPeferaato é ces&#iaesppenésonduwsvniuCiwuraobt diuedclts sp#es r utesepolctce tldeeedclts sp#es en didttsfàllatisenent c,dpourJlaaMiiline,ale rsacopies carbonsddedePV,Noie#asronibltl,odes daverdebureauxadedscrutin. br> sbr> brong class="spip">JISIGNÉstrong>&/, psue eséreprenenta.Msedûme tanommésadedePautees,ounrtroisJex mplarresrnragielux, auxadateaoet&ecdroits indii éstci-drssousbsp;;::sbr> sbr> p>

LLSG/OEAa/ GOUVERNEMENT DE LAnRÉPUBLIQUE D8217;avHAÏTIsbr> p>

L />p class="spip">LLPatis, décere ,a1510 br> sbr> sbrong class="spip">JILaë(nec Hurbonstrong>&/ ns spenvniefcst&auteclqnqi8217;anil0ns spsemblq emporoa.Msd cfarre ctenaîtreacsueil0ntrresrondpass zdexaes,me taà ces&#ia o leaamosivésed sao#encadierdu0Salonéduelrvse orsqieeno leavonsédé ené&denetnsacrer&ru CiursdN#e nodeaesnonséàfHaïtr.sbr> sOd ee eeutnqi8217;anlintrrHaïtr,aod ee eeutnqi8217;anldmirerales Haïtrues,aod ee eeutnqie neNpassemmpnecdre (à0moins&qi8217;ano.tisefèrens8217;anobsti.eraàls8217;ÉOenterrogrr,fmalgré lqs désill dions)dpourq oio#ena yséneNparvit.,eiasaàusor irad c 8217;anornièrq d saolaqurllq c rtainsa 8217;avontéflitevtrser.&Uee eetctensasnne,amsiseneslc eteitatl,tunpenjeu majesrNersrNqiele tldp ysfue anetmmunasiéaent rnaonnelre.&DsNqielacsuaesèrq,ecrtpenjeubsp;;:?nIl0eeNesppe raose talesqidlifi r,vd8217;anuneJfaçneNouvd8217;anuneJa ir . Comirnt&s8217;iaétnenercqi8217;an"on"aessayradealescfarre éar d. sbr> sbr> sHaïtru- Polctce tbsp;: :p>

JIRicsudo Sectenfus,aunruvéritée&#ianearlant&iasaàJl8217;iaOEAp class="spip">LL23/12/1510c08:27:37sbr> sbr> 24fhdures lpcèsélanaue icaonnesd cses crctce tldenverdel8217;iaONU et&l8217;avaentnInt rnaonnelreNd saouneéefearvueéaue iéeed sao#enq otidiennSuicirn#171;nbsp;?Lbilass="spip">JIL cTempssti>bsp;;:#187;M et&relayé0suredrenore ,uxasittddontéHaïtrLibrl,c 8217;anOrnisatréionNdeséÉttts Amérccainsr(OEA) aérapeesdasond#171;nbsp;?Lambasstdq lbsp;;:#187;M JIRicsudo Sectenfusstrong>&/. Il0va&s8217;iatnndrre e t&l diplomatepvaddevniuCs8217;iatxplci u asur ses rtisessdraposisnnesopee ii esedcva.,al8217;anOEAa&#iadé,ideraa#e la suittdà enener...sbr> RapeesteséqilsJIRicsudo Sectenfusstrong>&/ u saoc ttcfefearvueéacoiMélustt ieiis/éessdn#asmanièrendo.,elanetmmunasiéaent rnaonnelre gérant&sa relasnon ec ldHaïtrudeeuisr2004. Crctce a tasasaodétourJlaaMinuitah,el8217;iaONU,&l8217;avaentnd8217;anurgt c,,o#es ONG etlaffirma./nqira#171;nbsp;?Ls8217;anil0extsé fund preuvead c 8217;anéch lddp&l8217;avaentnent rnaonnelre,ro8217;avtsp&Haïtrbsp;;:#187;M emncu a./nqiras8217;anil0y acoiMéuee chosenqilslaaetmmunasiéaent rnaonnelre eevaaitépnecdre leetemps deactmpnecdre,ro8217;avtsp&l8217;avâmeNhaïtruend.«nbsp;?LLps etopéra tseso tapresséseetnHaïtrpesppongpactmp ex pwsdndlsrgeesepressésbsp;;:#187;M. (C8217;avtsp&égrlqmsnté 8217;avopinion exprimée psue 8217;ava.crdn Ptscrer masattrenJIGérard Latortuestrong>&/, b r.Nplacé pwsdnjugerJ nalanmataère.)sbr> sEnaeolctce t,uos /snvéritéen8217;avtsp&iasabnene àédirq,ecrcha tpfoncsinenarr dea62 asaovaddevniuCs8217;iatxplci u adcva.,al8217;anOEA,a&#iadé,ideraa#e la suittdà enenerpàésaemiiline qii eevlitJi8217;iaachenerau sao2dmois,amsisea soiesur l8217;anav diuedcllanearrièrendeaRicsudo Sectenfus...sbr> br> sEnasacr apu dNsur JIRicsudo Sectenfusstrong>&/bsp;;::sSpécialtsé fd8217;anHaïtr,éu ysésurJleqill i adaue ié&ru CiursdNwsvrageséd8217;anasa yieéhistosae t,aRicsudo Sectenfusaasétésl8217;antnvoyé0spécial&# sao#ena ysfuuéprenent M brene#ie Luea aco.,ad8217;avêtss0mn dtté psue 8217;avOEA.&Diplômlssntscrdncrs uolctce tld(Ueirseliéé de Genève 1973), diplômlssntéemnocre et déveloep me t ( Ueirseliéé de Genève 1973), diplômlssnthistoirq mod rnedetactfeemporarnee(Ueirseliéé de Genève 1978), doctoratNàll8217;avInssntutadps Ha é aoEtu#esnInt rnaonnelreld(IHEI )e(Ueirseliéé de Genève 1980). Ile séédea soibsp;: : PsmfecirurNàll8217;avUeirselidadtaFedera d cSo.,a Maria,erédaesq l en=c tfrdu Jrsrelr of Latin AmerccannInt grasines(Rila), Dirtesq l Générl dunCollègeeaeadémce tédee#roiMNàcSo.,a Maria (FADISMA), Consulta./ pourJleNMasattèrendes Affarresrétiangères dp m8217;anOrnisatréionNdeséNaonnes Uniese(ONU), Vice-Prenent Mrdec adctp iiline uuridce t (CJI) d c 8217;anOrnisatréionNdeséÉttts amérccainsr(OEA). sbr> sAuursrd8217;anhui, il tspplq Reprenenta.M0spécial&#urSecrééar d générl d c 8217;anOEAaet&C tfrdu Bureaueded 8217;anOEAaennHaïtr. C8217;avtsp&un epécialtsé freetenupdu Mercossr,den relasnons ent rnaonnelres,den diplomatre brene#ie ne, ete naeolctce t extérrdurevd8217;anHaïtraet&du Brene#.p>

LLL />p h3lass="spip">JIEfeartrue ac ldEveeseEmmn ill ssdn#escholérap class="spip">LL(novbre ,a1510)sbr> sLeNPsmfecirurNEveeseEmmn ill tspplq doyeerdec adfaculéérdestscrdncrs,&du géniq et&l8217;avarchctqctu ,eded 8217;anUeirseliéé de Qu se tya&àlPor -au-Prie,e. Iledarrge eNlaborator dodesqidliéé de l8217;antau etadp m8217;an nving>n me t. Ingéniquranivil, i ds8217;avtsp&forméelunG atsmaea aco.,ad8217;avobt diuesne doctoratNeerFranc,,éuuisJi8217;iatsppspécialtséau saol s prmblè ssnsaniéar ds.&sbr> sbr> p> <evees emmn ill />tnvoyéepsueDomasce t Ft rnier br> sEveeseEmmn ill tsppenregattréaicrpd saol8217;ÉOamphcthéât ,eded 8217;anJIEHESSstrong>&/ à Patis, où i addoenéeuee ctffénecc ,een=ctmpagnrd de brong class="spip">JILaë(nec Hurbonstrong>&/,tsurJleséeffetsadunoremblqmsntédeeterre sur l8217;antnving>n me tretélus esérareor s religrdux sbr> sb/cr.te < br> s h3lass="spip">JIÉaqctionsp class="spip">LLAu0mont.,eoùnil tsppe tltiona# crem(ttree addatq desééaqctionséà causlsdracrrtainsafaetaodedviolr.cle&#ianeadoive taiasato leàllatliéuréionNcrééedpsuela maeadie,Jbrong class="spip">JILaë(nec Hurbonstrong>&/ ns spprie de b r.Nvouer apue ieranedtextd de brong class="spip">JIDalynVtletstrong>&/ rarun#es12anovbre ,a1510cd saol8217;ÉOhebdomadar d bilass="spip">JIL cMatassti> de Por -au-Prie,e.sbr> sbr> brong class="spip">JIL cMatas Hebdostrong>&/ uus12anova1510- Spécial&Prenent M rl#ea1510 br> sbr> Textd d8217;ÉOenttoductinebsp;;::sbr> sbrong class="spip">JIVacuumbsp;;:!strong>&/sbr> sbr> Àfefesddrenparsu art déparsu acruxe&#i,apu dNou0moins&capabltl,raip"re tahumblqmsntéà ns spgvenrrn r, etecruxe&#i,afoncièreme taincapabltl,rrêve taincg>&rûmsntédeerégnerCsurJns spd saolanetetinuiéé de l8217;anHaïtrpàerépudi r,venesdaroiMéqi8217;anilleprt#e taos s&urtv tPqira 8217;avHaïtrudes steo ssesssismce tldrécurnectqs,odes sasa-abtis, duncholéra eMédcslnuragasaotauageurs, afvalint.,esonfrd8217;anidéal.éNoséft leaoet&éaqcte rsao taos ursrluéédetiadisnnenrllqmsntédeagai es se t me taux. Noséoptinesspolctce tldeeenodevmtes n crésultait.,eiasaforcémsntédeadé ibérationsénitoyeenesérasnnenrllqldeeeb r.Nieformées.nEt Dieu, nodeaffarrtsé aaeolctce tld#eséul s&fsiésNee ontégaissemsntétiréaprmfi,a# saolaJlg c téd rér. Ilsao tausé delts sp#es autefictsnete xpédien/ssiourJdéroutu a#aasasnne,aperveutiru#es apeess&lunaeuple, nodegai es necdez-vs spéaqctoraux, e/ pourJsubveutiru#8217;anordss0réaue icain. sbr> sbr> sLedvidenasogaimiatce téd saol qill s8217;ÉOenscrcta 8217;avacéurllq csmpagne éaqctoralsaenene froid&lundos.nOd assisotdà un,tttividli aonne deal8217;anidéd de ptojeMseet&deadéba/s, de trllq sor enqilslaamajosaté dedeen didttsfsemblq n8217;iaacr ae t&l urJbnene ou&l urJmauvaisesmase&àvoffriruaux&éaqcte rsaà titrd de ptogaimirs.&Ueovacuum &#iaseali,a# saolcslnpposisnnesobinarr séfactic sedu typec#171;nbsp;?Lctetinuiéé vs ehangeme tbsp;;:#187;M.éLaerupturq est-tele valint.,epossiblt tntren# aaeo sins&cnmp icrs,&aecent Mrllqmsntérivauxbsp;;:?nLena ysén8217;avtsp&iasavalint.,emobili éélus eségai es enjeux eteclivageséitaucturaux. C8217;avtsp&comirc#a mortNduaeolctce t enéoa./nqiralrduéd8217;anauteculasnne,ad8217;anagrégaonne et&deamédiasionNdesét nsionsret&ctfeaadictionsésociééaltl. nLesrdiscucinnes désrrte.,al8217;anesse t rl pourJsq csntnenercd saol8217;ÉOampl ficasineNdesétauageséaececioirestlutwurad c atlimp e rtiseNduaeosvniuCisuededNcmteries r utesaneséimpaoie tes.nDedNcmteries &#i,aàll8217;avasa yie,éneNpararcst.,eiasasuffesamme taprépsuéts àsmrduxpgvenrrn r etaàeeffectivtmr tadelrvsertqirac llesée 8217;anellqseusmjeMtr.,ad8217;avévacuerNduaeosvniu. br> sbr> sLeNcnmporsqnt.,edes élcteaaeolctce tldéélblies n8217;avtn finnt&iasadeadéntet da.cu art d8217;avtre ouaiess esééaqcte rs. C8217;avtsp&un exrrcice valint.,efastidieuxe&#eadedvouer ales siéuerNàll8217;avéch lreNdeséidéologrds,r# sao#e rsachoix e/ posisnnenrme ts ieaatégce tl,le,epsuerareor tà nodetwurme ts rérlsrdp aeuple. À laedé hargtsdracrllqs &#iaseamêlr.,ad8217;avinssntutinenali aonne eolctce t,uil fa tpreetenaitrd e t&l milrduéhaïtrueeneusteusêttdni matéri,llqmsnténi eultur,iesme taàal8217;avémergt c,édeagai es r uteseportursdN#e ptojeMsemobili ate rs. D8217;ava ta./nqirales mi-lieuxed8217;anauge tretédraposvniuCtnnHaïtrpieéso Méos ursrluhistosae tmsntéariangésepsuec oupnons ent rposésrewurantefise traleaeosvniuCisue#asr se,v adviolr.cl, les fraudesééaqctoralssatte#a&etrruption.nLeNfasancrnt.,edes csmpagnesodes dax-neufeen didttsfacéurlsfàllatisenent c,dseéflited saouneéopacaté déroutant , vor dosssuecé eeppongublantepewuranertains. nL8217;anabst c,édeacadiernormatif&ctfeaargna.,esteusêttdévidemme taauxatxoravaga c s rt dépensesééaqctoralssaincg>trôlétl. nLe jeu dp&l8217;avalt rna c,dpolctce t démocratae t et&régueièrensedreorvenr&comircfa soéadura.,acas jo é aoéaqctoralssaauxar,ie ts drdpoku aco&#in.sbr> sbr> Pourta./,ounrdépitsdracrt héritage arearemme taindé rotélblt,uil vadfalloir,fà ns veau,evmteralea28 novbre ,aprmchaie. Peut-êtrenqi8217;anun valialeadu acapabltaeMéos rné verdeleeehangeme t valiafinnraaparusor irad aournestet&seodétacheraewuranotss0bienedracas nore ,uxaprétedet ts&lunfa teuiléprenent M rl. No levs spprenentosao#e rsavilinesCduafueu adrenotss0u ystu saol s pagesé&#iasuive t. L8217;anabstr.,iod ee sauraiMdêtss0uneéoption.nLes fraudeséoffic rl#eséseeno rrrcst.,egénérl sme tadu0eteie temsntétacate etadp m8217;anapathaeNd8217;anéaqcte rsadémccinnenar ds.&ll vadfalloirevmter.=Mslgré os /.=Mslgré ccrCEPedé rié.=Mscinv me t. cSo.lepruraniactmp ex . Pour l8217;ana irenHaïtr. sbr> sbrong class="spip">JIDalynVtletstrong>&/sbr> brong class="spip">JIL cMatasstrong>&/ p>

L />p class="spip">LLbilass="spip">JILanvéritéetsppewurans spla eémocratae ornisatétdpenésociéédenivilsaet&enrgvenrrn me tapolctce t aToué l ctesteetsppfiction,usophisml,tmedenege, tyra.nid.éLaefictionén8217;iaauqi8217;anune areare.cl, leusophismlén8217;iaauqi8217;anune facl, leumedenegeén8217;iaauqi8217;anunetemps,v adtyra.nidén8217;iaauqi8217;anune arml,tqi8217;ano.t pdbtiseNtôt ou&tard d saolanmarn.nLes gvenrrn me tsevalint.,esolidedNee eeuve taiorturtqiralus unruvéritéectmp ète.nLeNrgvenrrn me tadémocratae t seal&#lNgvenrrn me taét rne d c 8217;anav diueverdeleqill ns spmarchonsbsp;;:;dtrllq tsppnotss0foi.sti> brong class="spip">JILamartasestrong>&/sbr> p>

L />p hrlass="spip">L />p class="spip">LLPatis, aoûMr1510 sbr> sbr> s821732;821732;No levennesodenreeevniuCnedtextd emporoa.Msd cnotss0aminJIGuyrPierrestrong>&/ etnsacréuaux&éaqctionséprmchaiees etaàe e rsatnjeux cauciaux. Ile séédeédiMéau saol jrsrelr bilass="spip">JIEl Paíssti>attemércttdévidemme taos /snnotss0attr.,iod. s821732; br> s rong class="spip">JI bilass="spip">JIHaitíbsp;: : unenore ,,aunaasación y un dedtaso a cambiarsti> btrong>&/sbr> br> sHaitíéreprenentaeterritorialmt.,e casiaunaaterceraapartd de unaad c aspmayor se slasadeléCaribl,tae#a&eulr losatspañoleséimp Ciurne elrnore ,edraEspañola o Hasraniola aefinesodelsirglo XV,faune t -según slgunas&fse tes- losaprimurns habitant séoaindíge aaolanent M ficabaeNcon elrnore ,eHaytí,éoasegún otsas,aQu se tya.éLaec tltiónodelsnore ,eqirallevabaacadaeterritorioad c atregaóeNespáalujeMa a ciertasatspeculacionessyrdiscrepa.cras,den tspecial&porv adtempra.aad sapariciónodev adrwblación indíge a local. Convren freetrdarnqilslaadelimitación territorialodev adIslaaEspañola sc eteitntuyó uurídicamt.,e en 1697Ncon elrTratadoad cRyswick,&porvelaculr laapartd oecent Mal&pasó a screptopiedad&denFrancia,ee t&l p Co elrnore ,edraSaint Domasg t,oulemiimoee t&fue cambiado elrprimurnedraen rnedra1804&porvelade Haitíétsas unas&caut Mas g trsas e t se aadicalizaronédurantep#a&etyunturaedra1802-1803,een=ctntraad c aspongpas e t NapoleóeNhabíadenviado ae#a&eoloniaNcon elrobjetivoédeeterminarNcon elrpod rédeeTs ssaint Loenrrturq yctestabltcu arlsirstemaad cesassvntu#. Perne a luchaodelspueblo haitraso impidióarlsregteso al&pasado ya#ogrótqiraluasación fueal&#auprimura inddsedeie tead cAmércca Latinabsp;: : luairgn ficado histórcco&seodtspnecdeodelsActaad cI edsedeenciaedra1804&yad c osaprimurns artículosfue anCteitntución haitrasaedra1805.&sbr> br> s821732;821732;Vu acoet dido eneJILa page "Actidliéé pourJlg>&temps"p class="spip">LLbrong class="spip">JILaë(nec Hurbonstrong>&/ souhaet eicrpwsvris unrupage eermanectetsurJleséeffetsadundéss=one,retélustt atreeteitauctionédueu ystuéjàectmir.cér. Il ee s8217;anagnt&iasaqirales mediadeeenoderwpueasineslnublie taau rythmlsdedNévéneme tl,fmalhdure x nuéluspneca.,s,rcapabltl&deamobili er l8217;anintérêMrdec adpresse aco.,aqie neNssdvieene aq prmchaie&aecent Meveesq l d8217;avémoonne et&deactmpailine.sbr> sbr> p> <Laë(nec Hurbon -ajanvrera1510 />tnvoyéepsueDomasce t Ft rnier br> sCettcfpage areartie taauxaHaïtrues qii o taàadr dae,aà é rire iwuraiorturttémorgnaglsdedNtedli asineslen=ct rs. brong class="spip">JILaë(nec Hurbonstrong>&/ ns sprapeesl eicrpl8217;animporoa.c,td8217;anuee eentétdtrsreésatt t M ère sur l8217;anaesnoneror eu eéd8217;anav diuetn foncsinerdec adplac,eqiranhacun ve tpreetenaîtrenaueu ys.nLeNchoix pourJleNdéveloep me t immédiastd8217;anuee ueirseliéé de gai eesqidliéé eeutnluspnecdre,rdrcmêmeNe t&l8217;avacct.,emis sur #aaséceciiéé de eteitntutine d8217;avuee bibliothèe t&ueirseliéar dodrcha tpeirsau. Pourq oiomarnt da.,bsp;;:?nN8217;avy-a-t-i &iasad8217;ana ireaourgt c,sbsp;;:?nLendomainq desééacteaai Mrllqcéurllqs,odes ueirseliéar ds,desp&celu deala mise en plac,ed8217;anuneJforcd de ptoposisnnesocentéts aiderponèsprapideme tretéefficacrnt.,elunfoncsinenrnt.,edes noenrereséitauctures matéri,llqs dp m8217;anÉttt.éLaeconsultation eatétddes lrvsestscrdntifae ts d8217;anaesidliéé ctntribuera&àv adformationeetaàal8217;avoenrrturq deséespni,s,rellq jusM fiera un dési odenresterCsurJplac,epourJunsuludNgaind nore ,,rellq sera un desésocledNurce,ipauxedu0système ueirseliéar dohaïtrueesuscrpsnbrepd crem(ttreepaisiblqmsnt,eepponèsprapideme t,een=causls 8217;ava.crdnneNstauctureésocio-polctce t d8217;avHaïtr.sbr> sbr> s sLeNJI4pmarsstrong>&/, ns sparrivead cMexcco&nedtextd de brong class="spip">JILesl reManigatstrong>&/ sur l8217;anhistoirq ded 8217;anUeirseliéé àfHaïtrsbr> sbr> sJIBrève Ese icirnhistosae t ded 8217;anévolusineNdeséinssntutines ueirseliéar dsCtnnHaïtrp class="spip">LLbr> sbr> sJI[Nmtes prépsuéts rwsdnl8217;avieformationerapide dedNmbre ,srdu0Comité ent rnaonnelr dedsoutrueert d8217;avappu àll8217;avUeirseliéé d8217;anHaïtrpiasattrée lpcèsél8217;anhorribreptragédieedu0séismledu 12ajanvrera1510]sti> Ns br> sbr> p>

LLDeséinssntutines ueirseliéar dsChaïtruendiaàdreeteitauiue, mod rnes vor doex mplarres,uau eirsausqidliéasnfrdrsJexigt c,sedu0système éducasnfrdrJl8217;iaedeergnent.,esupérrduretn foncsinenent.,ecomircmodèltsdracrée 8217;anesMéuee ueirseliéé d saol mondeeaeadémce téctfeemporarn.nHaïtrpneadoit&iasaprt#reanettcftrtsé foreor unitérdrJl8217;iahorribreptragédieedu0séismledu 12ajanvrera1510ert, u saoc téespni,,eunRraree d c 8217;anhistoirq deséinssntutines ueirseliéar dsChaïtruendiaeeutnledvir0àJctmpnecdre les prmblè ssndueu soéaetaàam(ttreern persuecéiveales noenrauxeimpératifs deachangeme t .s br> s Par JI Lesl reF.eManigatstrong>&/sbr> br> sbr> Leséinssntutines ueirseliéar dsCo tapris narcsa c CtnnHaïtrpd sao#enctfeextd de laefin deség trses Napoléneaenness&#ind l8217;iaEutoplsdedNoraatés deapaixedra1814-1815 vadornisatera 8217;anOecent MesesosJunenoenre ordss0mondialoec ld#lsrcg>&rès detaodedVrdnneNss spla ht lettead cMett rnichdd8217;anAuiran e,oec ld#8217;anhégémneaeNd c 8217;anAngleterse et&dea#anRucineea orsasymboli éeCisue#aslustt ded 8217;anéléphant (r sse) ctntrea#anbaleansa(anglaise).&Ueontec,rtéeutopéenéso sp#eNdirtesoirq deségai eeséuuissa c s aea orsaée i ibré le système mondialoJI(bala c Cof rwwer)sti> qii vads="urer&uee eérrode deapaixeenéEutoplsewuranine a t,tass,eunRdemi-siècle. br> sbr> Leséinssntutines ueirseliéar dsChaïtruendiao tapris narcsa c Cu saoc nctfeextd mari édpsuela ctnjrnctu ,eded1814-1816. Aurtemps du JIRoioChan"tgphestrong>&/ en relasnon,vd8217;anunccôté,oec ld#8217;anAngleterse eeséJIWilbrrforcdstrong>&/ etéJIClarksonstrong>&/ (Chan"tgpheCacoiMédedNtelasnons épn"tglarresrsuiveeselc ldWilbrrforcdretélustt lc ldClarkson,e#a&etrresronda ce ac ldca dernier&a faetal8217;anobjestd8217;anuedfort volumeéaue iéNàcSoa.fnrd&Ueirseliéy, Cdlifornie) etadp m8217;ana irenec ld#anRucineedu tsar JIAlexacdre Ier&/ (ec ld#lqill Chan"tgpheCa enauguré dederareor s é rits psue 8217;avent rmédiairq dedClarksonnqi8217;anil0a expressént.,emn dtté,een=b (neeetedueJforml,tpourJleNreprenenter&aupcèsédu Tsauedclts é aolds Rucines& ntren1816eete1820). sbr> sC8217;avtsp&en 1816ee téChan"tgpheCctmir.c Ctnngaind uee eolctce t d8217;avéducasnneénaonnelreNetédrapromoonne eultur,iese&#iaaséédepourJl#iaee e t seal&pourJJIBismarck&/ #171;nbsp;?Luee lustt pourJlaanivili asinebsp;;:#187;M emnearJle0clergé allemn datte#a&religrne eatholce t,uau eom&dea#annivili asine, leuJIKulturkampfsti>. Chan"tgpheCa été,een=effet, u saonotss0histoirq,ele gai ennivili asdureec ldsonnrégimdretélo.tisogaimir d8217;avéducasnneénaonnelreNetédrapromoonne eultur,ieseso sp#8217;avégide du #171;nbsp;?Ldtspoonsmleé lairébsp;;:#187;M, faesa./0joueruaux&philosopheséuhilanthtoplséanglaisdWilbrrforcdretéClarksonnslsrcg>seaiesrs eeeprécrpseurs, leNrôld de brong class="spip">JIDiderotstrong>&/ etnseaiesr eeeprécrpseur de brong class="spip">JICatherinq de Rucinestrong>&/ etéde Jbrong class="spip">JIoseph IIstrong>&/. Il0i8217;iatsppaidé,aà cestt fin,adea#anntopératinesec ld#8217;anAngleterse e.t pddemn da.,eune assisoa.c,atechnce téd saol ndomainq desémaîtres,odes méthod s rt destscrdncrs ded 8217;anéducasnne,ds="ura.,alui-mêmeN#enctûtNfasancier&intégraledclts é cestt assisoa.c,atechnce t. br> sbr> C8217;iatsppaissiéqirale JIRoioHenri Ptscrerstrong>&/ u8217;anHaïtrpadéélbli lqs precrèreséinssntutines ueirseliéar dsChaïtruendialpcèsé1816,s&#ind il0auraeaccumulé lqs moyeessdracrstt polctce t ec ld#8217;aneciorad c atprospésaté dedsonnroyaume. br> sD8217;avabnrd,uuee ctfcrpsnonad8217;iatnsemblq rwsdnl8217;avUeirseliéé comircuneéefeitéett nneNcomircdes ueités dispersées,oépsupaieéel,rledNAnglo-saxnesodaroit.,e#171;nbsp;?Lpiece-mealbsp;;:#187;M, en piècesodétachétl. L8217;anidéd d8217;avinssntutines ueirseliéar dsClc lddps foncsinesad8217;anunccorp sp#ogéed saounuvéritabltacsmpus embrynenarr i8217;iatspprédli ée&àvbrong class="spip">JISasa-Soucistrong>&/. LeséFaculéés etelqs ÉcoleséSupérrdurestlc lddps eharresrd8217;iaedeergnent.,e(ec ld#l rsatituearres)sdrs l(ttres,odes scrdncrs,&des prmfecinnes onotamme ta adiédecinl,&lestscrdncrs ded 8217;anéducasnne,dlestscrdncrs biologre ts dcteaaa orsa#171;nbsp;?Lnaour,iessbsp;;:#187;M&àv adtêtt desqurllqaolanehairq d8217;avasatocre eédastcnguaetaec ldsonnlaborator dospécialtsé,p#es auts&comirc#a peantu ,e(Un,taeadémce deapeantu ,),dlestscrdncrs humaiees etasocilldsCtnntêtt desqurllqaol8217;anhistoirq,ét naetalieu dp&laborator dopourJles scrdncrs uolctce tl,atte#a&religrne pourJles scrdncrs moralss. L8217;ananglais,oec ldsedNtessourcrs ded annivili asineéanglo-saxnensa(la ctncrpsnonachan"tgphrdnneNd saosaemod rniéé,NneNséparart&iasa#l&#a c tétte#a&eivili asine)&comircééalneNdes vale rsaà inculqueruaux&Haïtrues pourJunschangeme t nonnslulqmsntédea#a c t,amsisea soied creligrne, et&deacultur,,Ntedli a.,eune véritablta#171;nbsp;?LrévolusineNeultur,iesbsp;;:#187;M&u saoc ttcfa.crdnneNeolonie française. sbr> sbr> Leséinssntutines ueirseliéar dsCchan"tgphrdnneldéélie taintégréts auasomirstd8217;anuededeergnent.,eauxetroisJeirsaux,aprimairq,ésteondar d e,esupérrdur, psueune Chare ,eroyald d8217;avinssauctionépee ii e,aec ldsonnchanceli r,vsessdrgn éar dsCttvsessinspqcte rsadedNoroisJbranchss. Lbrong class="spip">JI8217;anAlmn acheroyalstrong>&/ rlaçart&individu,iesme taetanomméme talessdrgn éar dsCdarrget /stded anbrong class="spip">JIChare ,eRoyald d8217;avInssauctionéPee ii estrong>&/, nhacun àésaeplac,eso sp#8217;avlutwsaté dedbrong class="spip">JIDed anTastestrong>&/ etmircprenent M, dedbrong class="spip">JIDedDupuystrong>&/ etmircvice-prenent M et&deabrong class="spip">JIDedVasteystrong>&/, ntmircSecrééar d. L8217;anbrong class="spip">JIImprimuri,eroyald d cSo.a-Soucistrong>&/épee iaetaledNwsvragesédracrée 8217;anonépeutnaree ss eséPresses&Ueirseliéarresrd8217;iaHaïtrpntmirccreManill d8217;avinspirasineéanglccane , de théologrd,eédiMéaàcSo.a-Souci,Nss spla formltd8217;anuedlrvse bili c té(français-anglais)ssntusaglsd saol s écoleséchan"tgphrdnnel. Enfin,ail tsppà nsturtqiram8217;anassisoa.c,atechnce tétte#a&etopératinesétiangères (excu divtmr tabritannce t)sdrvlit.,eplac,dnl8217;avHaïtrude Chan"tgpheCd sao#enctfc,rtédes nationsé#ed annivili asineéded 8217;anOecent Mechaétrue. C8217;avétlitel8217;iahommledu dtspoonsmleé lairée&#iaacoiMébrong class="spip">JIFrédércc IIo#enGai estrong>&/ etmircmodèltsetecrafue etmircsymboliqud e t&l palaisdde Postdam oiMéétésl ndomainq royalcprucinen d cSo.a-Souci&comirc# palaisdchan"tgphrdnedu mêmeNeom&etmircpsuehasard.nLeNtsar Alexacdre Ier, disaiMNàcClarksonnauasujet&deaChan"tgphe,a#171;nbsp;?Le téc8217;avétliteuludNqiraluspneca.,re,ee 8217;anil0étlitevalint.,ednchanté dedvniuCunenoirCsurgiuau milieu dpdNoénèe ,srde 8217;anignora.cl, fo eer&ue emp"re noenrautsurJlesépilierséd8217;anuneJéducasnneéinspiréeCisuededNurce,ipeséchaétruesbsp;;:#187;M et&e 8217;anil0#171;nbsp;?LespéslitevniuCnednoenre Étttérivali er ec ld#lsrblancsCtnnto é ces&#iaétlitegai eneeebnebsp;;:#187;M.&sbr> .&sEnaappr da.,ela mortNdeaChan"tgphe,aWilbrrforcdra dé larébsp;: : by allrstandards,aheCwas aegrea,emn .nLeNroioHenri d8217;iaHaïtrpétliteue CIVILISATEUR. sbr> sT,ieseasétésla ctnjrnctu ,edednarcsa c Cueséinssntutines ueirseliéar dsCchez ns spàv adgenèst ded 8217;anÉtttéindésedet t d8217;iaHaïtrppsue eNgéniq chan"tgphrdned sao#enNnrd&dueu ys.nsbr> Un,tore ,eau&tabltaubsp;: : lreNdatd de brong class="spip">JIBoyeustrong>&/. La polctce t obscura.,tsé fde&celu -crpadvalufàllatiartie ded 8217;anEsM, hasrangphone,rdrcvniuCnesseraewuraun=b (=b utédeetemps #es acéivatés dea 8217;anJIUeirseliéé de So.,o Domasgostrong>&/, adplusavieaies Ueirseliéé des Amérce tl. br> sbr> Ue&druxième mont.,efortNdea 8217;anévolusineNdeséinssntutines ueirseliéar dsCtnnHaïtr, lpcèsélenctup d8217;avéasstpfondaseur de Chan"tgphe,aasétésla ctnjrnctu ,eded 8217;anavèn me tadecbrong class="spip">JISalomonstrong>&/ (87;9)aàal8217;avoccupasineéamérccain,eded1915,aec ldun eautnqidliéasnfra laefin dud19ème siècle etlaundébutédee20ème siècle ec ld#ant n tétte#es prmlg>& me tsedlsrcg>&rès pédagogre ts dudtrsrea tadu0siècle etnsacra.,eun necoenrautdrJl8217;iaedeergnent.,esupérrdurefondéessdn#asrénovréionNduésteondar d do.,el8217;ananimasdureesétésJIWindioraB lregardestrong>&/, dea 8217;anJIEcolenNnrmald Supérrduredde Patisstrong>&/. Ce mont.,efortNi8217;iatsppsntuénauasummumeded 8217;anapogéd de #171;nbsp;?L#asSociéédeHaïtruend de Lég slasinebsp;;:#187;M do.,ebrong class="spip">JIDantès B lregardestrong>&/eesécrctaqi8217;anellq étlite#171;nbsp;?Luee véritabltaAeadémce des Scrdncrs socilldsCttapolctce tsbsp;;:#187;M.sbr> sbr> C8217;avtsp&#anFranc,a&#i,acestt fois,as,rtéd8217;avinspirasineéet&deamodèltspourJlaantedsineNdeséinssntutines ueirseliéar dsCtnnHaïtrtiaree e t d8217;anuee eart,n#asréformltdrJl8217;iaedeergnent.,esteondar d asétéslargeme t tribuéar dodrclaemiiline françaisedreerutée&àvPatisepsueJIGuaieaumeeManigatstrong>&/ pourJleNlycéeénaonnelr JIAlexacdre Peonnestrong>&/, d sao#enasogaimir duNMasatt ,eded 8217;anInssauctionépee ii eébrong class="spip">JIFrançoisJSaint SurceeManigatstrong>&/,e&#iaasdoenéereptne àeladRépee ii evdrs l(ttresNd saosrs salnesad8217;anEnt Vaieaéet&d saol s déba/snparsume tairestlu=ct rs desqurlsa#171;nbsp;?Lle gai enmait ,eded 8217;anUeirseliéé haïtruendbsp;;:#187;M exposaiMNsrs vuestpédagogre ts (vniuC 8217;anévocaonnesd cce lustss0iet llqcéurledu mont.,ed sao#enlrvse decbrong class="spip">JIPaul Déléagl&/ #171;nbsp;?LHaïtraen 1886bsp;;:#187;M),éso sp#eNgvenrrn me tade Salomon,ert d8217;ava ir fpartalessdrplômésChaïtruescdes ueirseliéés françaisedNtevtnaie taau u ystm(ttree e rsacoenarcsa c s auasedvicd de l urJpasrit,uos /penésorgna.,e e rsaclie tsedlsrprmfecinnes ibéra#es rtivéts (iédecins,oecocaos,oingéniqurs,oegrmnoces,deneergna.,s,rfoncsinenarr s). brong class="spip">JILou s-Joseph Janvrerstrong>&/ esp&iarmi lqs ts é aoprecrèresépromoonnesadeadrplômésCdrclaevet ecélèe , #171;nbsp;?LÉcole des Scrdncrs Polctce tsbsp;;:#187;Mdrécemme tafondée&àvPatis. Janvrer, barré de diplômls ueirseliéar ds,desp&nonnslulqmsntépolctolog e,ahistosaee,dsnthtopolog eert jrsrelrtsé ,eb r.Niettodui,a# saolcslmilieux&iarisrues,aau uoasteqi8217;ano.t erchois ppewurapnecdre latiarole auxefunérlillqsé#e Victor Hugo ,amsiseil tsppa soiedrplôméCdrclaeFaculéérde Médecinldde Patis,ert drplôméCdrclaeFaculéérde DroiMNde Lillq, d8217;avoùnil fignol cses thèsrs sur #aaséceciiéé d8217;anuedrégimdrnivilaennHaïtr. C8217;avtsp&le0mont.,eoùnJIAnténor Firminstrong>&/ rédige ttepue ieésaefameu eémonograr ietsurJleséprmblè ssndsnm8217;aniessauctionépee ii eétnnHaïtr, d saosoedlrvse #171;nbsp;?LLpttresNdraSaint Thomasbsp;;:#187;M, adprecrèrenasa yieéscrdntifae t ec ld#lesupeor td8217;anuedemporoa.Msareareir dedstatastce tsescglarresrd créfénecc l,fmptta.,e eadoig,a# saolaJplare. brong class="spip">JIAudarnstrong>&/ 8217;anavoiMéditbsp;: :uil fa tp#171;nbsp;?Luee réformltdrJnotss0système d8217;iaedeergnent.,eaue ice&#iasubssntuera&àvc téédifict lézardé, disjoast,Jbranla./,ouedédifict ns veau,ed8217;anauchctqctu ,erasnnenrllq,esolideCttvsélblt,uuuissa ,re,emagn fie tbsp;: #187;M.&Ac lddpdtrllqséidéps fusa.Msd cparts é,d#8217;anecioratsp&doenéeewuranestt steondt flambé Cueséinssntutines ueirseliéar dsCprvrt me tadites.nbrong class="spip">JIFrédércc Doretstrong>&/,eeccoresétudia ,renNgéniq # saolcslaenéesrd c1897&àv1900,ovaddev diueueNdeséingéniqurs émase.,sedlsrprecrèreséaenéesrdu XXème siècle haïtrue.nLeNbrong class="spip">JIDr LéoedAudarnstrong>&/, drplôméCdrcFranc,,éa.crdn ent rn CueséhôpitauxadedPatis,ersp&dev duuuee célébsaté médiclre.&R ntréaau u ystewuray fo eer& 8217;anJIÉcole de Médecinldd8217;iaHaïtrstrong>&/ vet ectenutspourJsonnartNduadiagnossnc&àv adfrançaise, i dseeferaauee réputation notor dopsueundgenrqnqi8217;anil0auraeculéivéaec ldsuccèsbsp;: :u#171;nbsp;?Ll8217;avétude socilldbsp;: #187;M.&Il0jouera un rôld de ptscrer plannauasteondrcg>&rès pédagogre t de janvrera1904nqi8217;anil0prenentra eMéclôtu ,ra. C8217;avtsp&le0genrqnd8217;anhtmir-orchsst ,eded#171;nbsp;?L#asha teésociéédbsp;;:#187;Mdqi8217;anunemasatt ,eded 8217;aniessauctionépee ii eéaimaiténiter, pde t&l Dr Audarn a salué comirc#171;nbsp;?Lle gai enmaît ,eded 8217;anUeirseliéé haïtruendbsp;;:#187;M. sbr> p>

LLL8217;anbrong class="spip">JIÉcole de DroiMstrong>&/ pnecddnarcsa c Cso spSalomon,eà la suittdd8217;anuee inntitsivsd rtivét qii eeviecdradééltce téctmircFaculéérde DroiMNde Por -au-Prie,eaec ldunearléiade deadrplômésCdrcPatiseet&deaBordrauxeurce,ipal me t. brong class="spip">JIBoyeu Bazelaisstrong>&/eevoiMéfaiMNsrs étu#esndeadroiMNàclaeFaculéérde DroiMNde Patis. brong class="spip">JISténio Vinct.,strong>&/, #171;nbsp;?Lle surdoudbsp;;:#187;Mdded 8217;aniet llqcéudliéé dundébutédu XXème siècle,aasill dtréaparusoedéloe te,eahorsapa ales nrrtusndsnm8217;anartNorator dod saol s prétor dsCttv orsa#esnjubilésCdrcgai es mait ,srdu barrtau etadp manmagattratur,,Nos /penéaya taétésl8217;anhommledu diagnossnc&sûrNduamal d8217;iaHaïtrpdo.,eil0acclblaetaledNéacteaatiadisnnenrllqs.«nbsp;?LPar ts spsesepor s, la sociéédehaïtruendesupeur,bsp;;:#187;M.éLe DroiMNauasedvicd du socillbsp;;:! Enaearoles d8217;anabnrd,ulaissa ,rewuraplusatard auanrrbe deas cfarre chair821730;aec ldsuccès nuénod. sbr> sbr> Ce mont.,efortNtsp&#and rnièresétape aco.,alaantedsineNdea 8217;anJIUeirseliéé d8217;anÉtttéd8217;iaHaïtrstrong>&/ définntivsdec ld#anctnjrnctu ,ed8217;anéveir eultur,i st&autestce tédeséaenéesr1940-1960. J cfarscréfénecc Cso ve taàanestt #171;nbsp;?Lctejrnctu ,ed8217;anéveirbsp;;:#187;M&àv aqurllq j8217;anai etnsacréuuneamonograr ietd saomoedlrvse #171;nbsp;?LJINoenrauxectmba/ssiourJl8217;avHistoirq Viva t,td8217;iaHaïtrsti>bsp;;:#187;M. Cett ectejrnctu ,eded1940-1960aasjeté lqs fo eeme tseprépsuator dsCàal8217;avéd ficasineNdu noenrautsystème éducasnfr&#iaallaetaaccueaie ales noenrereséinssntutines ueirseliéar dsChaïtruendi.nOd anjudic rus me taét ndufàllatiérrode tt t M ère le0mot embléiatce téde #171;nbsp;?LRenarcsa c bsp;;:#187;M&orvenéalus unrupa.cartd de #anRue du Cefear, duncôté npposéaau Pénitencier&Naonnelr &#i,alui, inspiraiMNàcunehumortsé fund a ir fpa.cartdbsp;: :u#171;nbsp;?LOeNesppmrduxpicrpqi8217;anen faclbsp;;:#187;Mbsp;;:! La&orvenlillqedu motéde #171;nbsp;?Lrenarcsa c bsp;;:#187;M&étliteued a bain,ecsuerllq raree aetale gai enmont.,eexcrpsnonnll d8217;avérang icirnt.,edes l(ttresNrt destauts&néaau Quattroct.,o iéa#ie àtiartir de F ore.cl, &#iaasctee iclts é 8217;anIéa#ieaparusesa#1339;uvreséinspiréesndsnm8217;anAntce até mptta.,e 8217;anhommlelu=ctntren# Nos /penéunehumisatme ueirseldli a.,, et&e i i8217;iatspprérandu enéEutoplslu=XVIème siècle.nOd anvuuuee ctmpararcne feutilq rwsdnl8217;avérang icirnt.,eiet llqcéurlest&autestce téhaïtrueeded1940-1960ast&apcèsé(paruex mplrc#a peantu ,ehaïtruendenaïve,aprimntivsdou0mod rnedec ldsedNc tfs d8217;an#1339;uvre),ésaali,tératur, exprima.,e ea#171;nbsp;?Lmerveillquxbsp;;:#187;Mddu géniq eultur,i haïtrue,evmdouéctmircreligrne eMécréole&comirc#a c t,actmpnis natur,iesme t. sbr> C8217;iatsppu saoc nctfeextd e tédeséueités noenreresévieene.Msa orsaétofferaleatessuNdeséinssntutines ueirseliéar dsCtnnHaïtrtec ld#8217;anethnologrdspourJlaqurllq so MécrééaouneéEcolend8217;anEthnologrds(qii eeviecdradplusatard uneébrong class="spip">JIFaculéérd8217;anEthnologrdstrong>&/, ptscrer doyeerbrong class="spip">JIJean-Bap,tsé fRomainstrong>&/) etaun=bureaued8217;anethnologrdssurJleqill brong class="spip">JIJace tseRoumarnstrong>&/ arcstraosaemari e, un,tttoupt folklosae t naonnelre e8217;anÉttt, un,tÉcolenNnrmald Supérrduredd8217;iaHaïtr, rwsdnl8217;avedeergnent.,edeséL(ttresNrt destScrdncrs (ptscrer dirtesq l brong class="spip">JIPiadll Ptmpilusstrong>&/),ouedCtntren#8217;anArtN(ptscrer dirtesq l brong class="spip">JIDewi,t Peoersstrong>&/) etaun=Foyeu des Auts&plastce tse&#iasero talesspépinières dp maafueu eébrong class="spip">JIENAERTSstrong>&/ (EcolenNaonnelre ees Auts) , uneébrong class="spip">JIÉcolenNaonnelre ees Ha é aoÉtu#esnInt rnaonnelrelstrong>&/ (ptscrer dirtesq l brong class="spip">JILesl reF.eManigatstrong>&/),o(qii eeviecdradl8217;avInssntutaNaonnelr de Gessineéet&des Ha é aoÉtu#esnInt rnaonnelrel (brong class="spip">JIINAGHEIstrong>&/),ouercFaculéérdestScrdncrs Socillds,ouercFaculéérde Li c estce t,ouedCtnservator doNaonnelr de Musce t,ouedCtntren#8217;aninvessigaonne entscrdncrs socilldsC(CHISS, ptscrer dirtesq l brong class="spip">JIHub,rtéDero ceraystrong>&/),os8217;anajoutant auxenoyaux inntitux eteclassii esedcclaeFaculéérde DroiM,edcclaeFaculéérde Médecinldrt d8217;avOntologrd,eded 8217;anEcolenPolytechnce té(a.crdnnent.,eEcole des Scrdncrs areliquées),edcclaeFaculéérd8217;anAgrieultur,).&UeorectoratNesMécréé,e&#iaseraNplacé so sp#8217;avlutwsaté du Dr brong class="spip">JIJean PricreMarsstrong>&/, iédecin-ethnolog t,-histosaee-ent rnaonnelrtsé ,e#8217;avluteur de #171;nbsp;?LJIAissiéparsadl8217;avOnclesti>bsp;;:#187;M,Jbrefaleaf e rne deal8217;aniet llqcéudliéé haïtruend de réputation mondialt. br> sbr> Voicrpv diuemarnt da.,,aewuraune emncu line ssdn#es#171;nbsp;?Le téfarrebsp;;:#187;Mdhaïtrueeueemataère des besoins&de renoenrerent.,edeséinssntutines ueirseliéar dsChaïtruendiar.Nv téde farre mrduxpctmpnecdre latliéuréionNdueu ystuéjàeaco.,aetélustt lpcèsél8217;anhorribrepséismledu 12ajanvrera1510,&un exposéad c atprobléiatce téet&deadirseléprmblè ssndsnqille téimporoa.c,te i i8217;iatnsuive tdou0y so Méliés,rcarale JIComité Int rnaonnelr dedsoutrueert d8217;avappu àllastrong>&/ JInoenrere Ueirseliéé d8217;anHaïtrstrong>&/ auursrd8217;anhui oiedut me tafrareée etlacéurllqnt.,esasattrée,ersp&sasa do é uludNqirad8217;ana irea,aintéressé àése ren#reantmpt,eded 8217;an#1339;uvreaàeentrepnecdre ewurantetribuer moralsme taetamatéri,llqmsntéàam(ttreesurJpied&denfoncsinenent.,euee ueirseliéé haïtruend drgnesd cce nom. sbr> sbr> 1).u1; La precrèrene tltionarsp&su a#aasasurtétte#a&foncsinenaliéé de l8217;anUeirseliéé d8217;anHaïtr. Neadoit-tele iasaprmfi, rédeenettcftrtsé fépreenr&pourJsq posu a#aae tltionaoie lreNdoiMNctetinuerNàlêtss0du #171;nbsp;?Lsteondar d prmlg>&dbsp;;:#187;Mdcomircje 8217;anavoistuénoncépenéune saut,td8217;iahumeur de eteitatNjusM fiédou0dev diueued a ihentce téueirseliéé,Cnessa.Msd cfarre du=ct rs magattralal8217;anesse t rl drJl8217;iaedeergnent.,esupérrdurea orsaqi8217;anil0en resé 8217;anossasurtéurce,ipal bsp;;:?nRrueeneusauraiMdr mplaceraun=b (=psmfecirurNd8217;anUeirseliéé d saounuct rs magattralaportursert drstribuéeur desacoenarcsa c s aeadémce ts&lunaludNha tpdegré du sacr ahumaie.eMaisddep iclts ursrl, o.t pdadvoueuuueaacctmpagnqmsntédeetravauxeuratce tl,adeetravauxedarrgél,adeeuratce tlad c aborator ds,ed8217;anessailéprmbator dsCdo.,el8217;animporoa.c,ttspprectenutsau0moins&dep icl#andiff line dp manméthod e xpér me talq dedClaude B rnard.nOnden tsteeccore, u saoc rtainsacasad8217;anutili asineéded anehairq,aau #171;nbsp;?LparNc#1339;urbsp;;:#187;Mddictépenésalltsdracss="dae,aà #171;nbsp;?Lrendrebsp;;:#187;Mdsasa om(ttreeuee virgulq rwsdn asisfarre auxatxamt.s moyee-âgeuxedesdfaculéésad8217;anunca ir ftemps.uJIDd prmfundissti>,adunoréfo esedcclaedétresse haïtruend prenente,el8217;animpératifdd8217;anuee a ihentce téueirseliééndsnqialiéé tsppu8217;anêtss0nteformltauxatxigt c,sed8217;anêtss0napabltade eteitiéuerNun,ttêtt eenta t,tauasomirstd Nos /ple système éducasnfrdueu ys.nAenodevrsiseamisdde ns spy aider. sbr> sbr> 2).- La steondt e tltionarsp&#aaséceciiéé d8217;anornisatera atreehern e,oeutreantmpagnon drJl8217;iaedeergnent.,emagattralae i imp ce t déjà,uil fa tplepreetenaître,ouerclargefparta#8217;aninvessigaonnes sur saemataère psue eNpsmfecirurNd8217;anUeirseliéé. C8217;avtsp&unt obligaonne dedsonnmagattèss0iet llqcéurlede renoenreerusoedct rs enésepreeycla.,acteitamme t. Jeumeprapeesl ,laundébutédeemaacarrière,oueNeollèg t se gargatisa.,edes noé aoécrctrs sur paprerajaueiaqi8217;anil0exhibaetaec ldune suffesacc Csasisfarte.n Maisdc8217;avétlitehrerbsp;;:!... Auursrd8217;anhui,a atreehern e enéoa./nqiratesl ,lueedehorsa#ea#anbesac,epsmfecioralsaindividu,ies,ersp&ornisatétdenéunecorpstuédiéuaux&invessigaonnes scrdntifae ts. Leséctntresodenreehern e scrdntifae t pullulr.,aparts é etec8217;avtsp&àllatb (neehdure. Auursrd8217;anhuia atreehern e dépassrJl8217;iaedeergnent.,epsmfecioralcd saol8217;ÉOenrichicirnt.,edes coenarcsa c s,treehern esaindividu,iessC(dpdNohésards,aparuex mplrcouNdeséehern e rsadedNécolesépostdoctoralss))couNreehern esaeollecéivesC(ledNée ipesodenreehern esCdo.,eldsCprvdui,sn#8217;aninvessigaonne areartie nt.,eauxeée ipeso,iess-mêmes nuéso sp#eN abrledeséctntresortivés nuéaue icsuau eom&ctenu eeepressigrdux nOd areartie taàdtrllq ou&tellq écurid.éLaecirculasnneadedNée ipesodenreehern e& ntrenl s pays tsp&le0srgnescoenrautdrJla suprematce des chosesndsnm8217;anespni,od saol s noenreresétechnologrds du sacr ahumaiecd saol8217;ÉOhumisatme des chiff ds.&Il fa tposaee, rédaco.,aglsreséinvessigaonnes scrdntifae tsChaïtruendiaverdelatreehern e eollecéive. br> sbr> 3).- Cerea tad uludNpcèséleléprmblè ssndsséinssntutines ueirseliéar dsChaïtruendi, uil fa tpm(ttree 8217;anacct.,esu acruxeà qii o dedeergne et&e oi l urJedeergner.nOd anpnis l8217;ÉOhabitude deapensertqiram8217;anUeirseliéé,Cne so MélesNpsmfecirurs.nEt adrwpueasine tspudia ,in bsp;;:?nVrdnt-tele slulqmsntépour survse #lsrcgursbsp;;:?nOd anvuuqiram8217;anUeirseliééaaccueaiee 50.000sétudia ,sCàal8217;avedeergnent.,esupérrduredo.,ela moitiéufréqse te&régueièreme tal8217;anUeirseliéé d8217;anEtatN(UEH).ornisatétdené13dfaculéésaet&ÉcoleséSupérrdures. Lesébesoins&de c,epesnt mondeeso Mételasnvtmr taénormes.nEt eNpsmblè s des bgursesaparuex mplr,én8217;avtsp&iasarenoluesesosJ#lsrcni,èresrd8217;iaappropniasineéet&deajusM c , vor dodes besoins&pniwsatarresrd claasasnne.uJIQuidsti> d8217;anuee erise en hargtseartielldretélous cg>trôld de #ansolusineNde ceNpsmblè sbsp;;:?nOd pourraiMdmêmeNintéress rédaco.,aglsra&etopératinesétiangère dèsél8217;anamontédea#a séaqctionpewurapnépsuer& 8217;anacoledesédedtasaonnes naonnelrel et ent rnaonnelrtl. br> sbr> 4).- LeNpsmblè s d8217;anunccsmpus ueirseliéar dolc lddps senent c,s ueirseliéar dsCpwurapnmfecirursoet&étudia ,sCcomircen Franc,aouCàal8217;avJIUeirseliéyCof ihe Wtsp&Ideielstrong>&/ (Mnel, Jamaïe t)satbuéé,Cje le0sailéparuexpérrd.cl, sur l8217;anobitacld de #anméfianc,agvenrrn me talsaànctfc,ntres unrupwpueasine étudia ,saàncapacaté subveusive. A druxNreprised, o.ta eud anehancd de ptépsuer&un eittdpourJunscsmpus c,ntral,el8217;anun àéCoé a-Plageséete#8217;avlut ,eau&ranch de Jean-Claude,dlestmaqurttdsCpwuraehae t Faculéére,eEcole Supérrduredéoa./ntechnce tme taprépsuéts psueune firmltspécialtsée. J8217;anen parsueen=ctnnarcsa c Cue=causl,éaya taeueueemaisaolanmaqurttdNdea 8217;anJIEcole des Ha é aoEtu#esnInt rnaonnelrelstrong>&/ mise au uoastesesosJmsséinssauctions des besoins&de 8217;anEcolenlpcèséconsultations ec ld#lsrétudia ,sClesNplus cg>c rnés.nLeNpsmblè s sepreposu auursrd8217;anhui en ter ssndiffénecMseet&p ic,uil y a des noenrauxecsmpus exisoa.é etefoncsinena.,ecomircm8217;anUeirseliééaadve ttsé fdisposantédeavastesatspacrs muléifoncsinenelc,uyactmpnis #es acéivatés sporoives,eà Dce ani.&Ac ldlaedéctfc,ntrasnne,dlestdélocali asinesletdlaedéc,ntrali asineéenvisagéed, o.tauradl8217;avoccasineNde dnenercunenoenrauanisaglsau u ysaglsueirseliéar dohaïtrueed sao#encadierd8217;anuee régionali aonne àpv diuea orsaqilsra&eteitntutine a omicl#anrégiona# saolaJltsé fde&sesaeollecéivatés territorialtl. br> sbr> 5).u1; LeNpsmblè s coenrautdrs ueirseliéés rtivéts.&Il y anpnolifératinesd8217;anueirseliéés rtivéts qii ps sst.,ecomircehampignonslacéurllqnt.,ess spla ps sséd de #anmassificasineNnumérce t etasocilld des bachelierséveea tadu0baccllauteds psueplus d8217;anuee ce tainesd cmaie selépsuen .nLa slulqéueirseliééntsp&innapabltade #es accueaie .nOd nt sealrt&iasaà0moins&de tre te&maiee bachelierséhorsa#ea#8217;anUEHéins rits auxeueirseliéés rtivéts do.,ela plupartafo tadu0#171;nbsp;?Lbusieessbsp;;:#187;M, c8217;avtsp-à-dr dafasancièreme talucratavts.&DrcmêmeNe t&ledNécolesé#171;nbsp;?Lborlettesbsp;;:#187;Mddu steondar d,uil y a cg>tamasaonnesd8217;anueirseliéés #171;nbsp;?Lborlettebsp;;:#187;M. UsJ#ousM céoptimtsé fctmir.tliteqi8217;anil0va tpmrduxpacr adrs ueirseliéés #171;nbsp;?Lborlettebsp;;:#187;Maqie neNiasaenéacr adudtrstbsp;;:! Il y auraiMd150éinssntutines ueirseliéar dsCprivéts do.,euee quara.,ainq rectenuts psue 8217;avÉtttbsp;;:! La&ptoporsineéeneergnent.,esupérrdureaue ice téeneergnent.,esupérrdurearivé esp&iréoccupa.,ecsue 8217;avajusMqmsntédea#afctexisoe c,dposeNpsmblè s. Par ex mplr,élaeFaculéérd8217;anÉtttéde Médecinldadirstehae t aenéecunemaximumededdruxNcecMseétudia ,sCpsuenoenrere promoonne d8217;iaedtrée. Use slulqéueirseliéénrtivét iarmi lqs plus sérrdusesaeomircm8217;anJIUeirseliéé Notss0Daml&/ ouCm8217;anJIUeirseliéé Qu se tyastrong>&/ en adirstreNdoue ebsp;;:! Lrs stageséendiédecinlod saol s hôpitauxaaue icsupwuraêtss0colabltl&epprectenuseso Mélu=ctmpt,-gvettdsCetalessdrplômds du arivé doive tdêirenecaltsés psue 8217;avÉttt. Certainrs spécialttés ns seporvenesteqi8217;anàa#8217;anUEH.nLa rivalitépentree 8217;anÉtttéet eNpsivé telèvdNdea 8217;anépoe t ded 8217;ano.,agosatme entreecutesaetamairesNd saolqs filmsa#eaMareel Pagnol. Évidemme t,Cje caricasurtéunépeu.&Il tsppà nsturtqiramrs meillqurrs ueirseliéés rtivétseso Méàllatioaste du aro&rès dasao#e rsabranchss d8217;anaesivatés,oec ld#8217;anaide desra&etopératinesétiangère. Enfin,adeséaecrdnneldécoleséd fctmirree réputéestmaisdde nirsausrt d8217;avaccès au-dessousadu0baccllauteds,as, so Méconnrrtnes& neEcolesesupérrdureséd fformat ueirseliéar doldmil. br> sbr> 6).u1; Und a ir fe tltionarn déba/dsasa farre orvpédeavaguesdesp&cellqedu choix ntrenl sacr afondame tal spécueasife téesthétce tme tapréfénecM rl classii e (#8217;anagtede ebsp;;:?)éet eNsacr aàedesdfins&pnagmatce tla(#8217;anutilebsp;;:?),d#lsrcg>narcsa c s théorce tleet&philosophce tlad c 8217;anhéritage gaéco-easieadedNPlatneéet&Aan"tgttétte#es formationseuratce tladu&pnagmatctme anglo-saxnes,rformltssdviva t,tdrclaeveeaiee querellqededNAncruescet&des Mod rnes.nOd s Cso vie./nqirans spavionseorvenéa eNpsmblè s poséad saonotss0étude su a#aasubssntusineNdea 8217;anhégémneaeNamérccain,eàllatirépondéranc,afrançaised# saolaJctejrnctu ,e1910-1912.nOd an arcsé farre lenctursadedNchosesnssdn#espsmblè s etecrlara débouchéalus d s rnjeux ttratégre ts emporoa.MssiourJlaasasnnebsp;: :uéactctme ou0massificasine, ibreNchoix ouNdarrgctme,CnesddruxNhéritagesrd claatiadisnne eultur,iese&#q j8217;anai placésa# saolaJlo c téduréeCbraudélruend et do.,ebrong class="spip">JIMirli eesManigatstrong>&/ vie./nde0srgna ss e caraesère discrimasaoor dod saol ursoeffets.nLeN arcstr-farre individu,i etefamilialal8217;ana emporéé,Cmaisdladpressionaoocilld a peaneaàeen&etrrigss esésronoa.éatés. br> sbr> 7).- LeNpsmjet&dealoi sur l8217;aneneergnent.,esupérrdurets ursrlrenNgestation tardeaàerégleu des e tltions enésuspens&de 8217;anè dodrclaemod rnisasineéet&dealaemondialisasineépourJles inssntutines ueirseliéar dsCtnnHaïtr. C8217;avtsp&u saoc ttcfcatégosaeeqi8217;anil0fa tplisterCl8217;animporoa.c,tdeal8217;aniedicd du déveloep me t humaiecd saoledNchoix ttratégre ts à farre en praxéologrd,e adformationeldminattrativsdetatechnce tédu personnll dlesupeor tet&deasonarnoraanent.,espécifae t sector rl,cd saoledNinssntutines ueirseliéar dsCtnnHaïtr, lepreetsrlrauxenoenreresétechnologrds,el8217;anint rn taàal8217;avécole,e#8217;avlménaglme taeta#8217;anutili asineédes locaux tcglarresret ueirseliéar d,l#andirselificasineNdu cg>trôld ctetinuedes coenarcsa c s,tlaemesu dodrclaecroissa c Cctmparédod saol s polctce ts promooricrsret etrrecoricrsrdu aro&rès humaiecsesosJ#lsrcni,èresrliéseàllatiersonnaliéé de bast dedehae t nivili asine..éLaecoopératinesent rnaonnelrtNdoiMNet vanrégn rédasaoc sndomainqsndsnm8217;anieterventineshumaiee, et&HaïtrpdoiMNsaisirdsonnmalhdur comircuneb r.NpourJles sa tsaenéaco.,aqie néceciiée&nonnsonn#171;nbsp;?Larriérrsmebsp;;:#187;Ma(crlarne eédateulud)Cmaisdl8217;avlrehaïtme densonnstade desdéveloep me t. br> sbr> LeNComité ent rnaonnelr dedsoutrueert d8217;avappu àll8217;avUeirseliéé d8217;anHaïtrpéprvenéedec ldsixeueirseliéés rtivéts détauitdsCetapresqirats é aolds a irea,alatiee ii eétMélesNpsivéts,cd saoledNviiess-martyreséd fbrong class="spip">JIPor -au-Prie,estrong>&/, deabrong class="spip">JILéogânestrong>&/, deabrong class="spip">JIPesnt Goâvestrong>&/, deabrong class="spip">JIGai e Goâvestrong>&/ et&deabrong class="spip">JIJacmelstrong>&/,eecdommagéed iarmi lqs meillqurrs dueu ys,NneNpeutne téctmpnecdre et&épaulerCl8217;anélanndedsolidariéé comeentaoor dodunmalhdur &#iaacclblrc# paysohaïtrueed sao#aedétresse,e téendééltndedgrâ,eaeupcèséd 8217;anopininesent rnaonnelrtNsuprrbemr taém eétMémobili éd deva.,e 8217;aniefortuee injusMq e t&l peuple haïtrueNneNméritart&ias.nLeNbeau motéde solidariéé tsp&le0moMsd cpasse en fec urNd8217;anHaïtr. br> sbr> brong class="spip">JILesl reF.eManigatstrong>&/ br> sPrenent M du0Comité Int rnaonnelr dedSoutrueert d8217;avAppu àll8217;avUeirseliéé d8217;anEtttéd8217;iaHaïtrN(UEH). br> sbr> br> s sLeNJI23 févrrerstrong>&/,onotss0amce brong class="spip">JIMarie-JosèpheCTardrdustrong>&/ ns spinformltd8217;anuee inntitsivsdmajduredqii vadsepo diueà Modtréaleueemarlr1510ertdqii révèltsb r.Nlaevmlg>éé de onèspnore ,ux&int llqcéurls,erxilésCouNdemeuréssau u ys,adeeuarti,iperJedeemblq àelatreeoessauctionédueu ys,NsurJplac,.sbr> sbr> sJIReeteitauiue&Haïtrp- Hor zoné2030bsp;: :uueNeolloe t histosae tstrong>&/sbr> sbr> sModtréale-&le019 févrrerr1510e- br> sD saolaJpersuecéiveadrclaereeoessauctionéd8217;iaHaïtr, do.,ela capitalldrt d8217;ava ireaoviiessao taéédedétauitdsCpsue eNiremblqmsntédeaterse eunmardr 12ajanvrera1510,&une vingtainesd8217;anornisatmeseet&deaiersonnaliéésé#ed annommuna ié haïtruend du Québ ldo.,acteitntuénueNGtoupt de réflrxioeert d8217;avactionpewuralaereeoessauctionéd8217;iaHaïtr.s sLeNurce,ipal objecsnfrdrJceNGtoupt rsp&dedformuleu des ptoposisnnesocrncrèteaaaux&insoa.c,s cg>c rnédsCpsue aereeoessauctionéd8217;iaHaïtr, enésepbasa.,esu adps seflrxioes menédsCsesosJuneaappron e uarti,iptsivs, enémptta.,eàantetributionéltl&exprrtnsesCttvsensibilités dispneabltl&ta.,eàam8217;anietérrdureqi8217;anàa#8217;anextérrdured8217;iaHaïtr.s sPwuray uarv diu,ele gaoupt se ptoposs, ent ,eaut ds,ed8217;anornisateraueNeolloe t oenrrt et encu lif,e&#iase tiecdradltl&4 et 5emarlrpron aisaoàa#8217;anÉcolenPolytechnce téeesModtréal.s sL8217;anientitsivsddu Gtoupt de réflrxioeert d8217;avactionpewurauneaHaïtrpnoenrere asétéssaluée psue eNpsscrer masatt ,ehaïtrue,eM.bsp;: Jean Max B lrerivebsp;: :u#171;nbsp;?LJtNsuisdhdureuxadedc ttcfientitsivsd&#ianeNpeutne 8217;avaffinsr eeeper sttren# Nmrduxposaee, rélps seflrxioes ientiédsCpsue eNgvenrrn me taet, au-delà, ts spcruxeqilsra&ssdviedd8217;iaHaïtrNintéress bsp;;:#187;M, a-t-ir dé laré.«nbsp;?LNs spuartaglnes ue rêvebsp;: :ucelu édeavr aHaïtrpntmircunépaysoémerget /n#8217;anicié2030, sociéédedea#a simp cciéé,Cée iélblt,ujusMq etasolidar d,lviva t enéharmneaeNac ldsonnenvirnenent.,,ésaaeultur,ret ueeemod rniéénmaît i éd où 8217;anEéltndeddroiM,elaJltb,rté d8217;ans="ociltioeert d8217;avexpressioeert #8217;avlménaglme tadudterritor doso taéélblis,edotéltd8217;anuee éctfocre mod rne,rforte,edynamce t,ocomeétisivs, oenrrtdae,aà largefbast territorialt, où 8217;anedeemblq des besoins&de bast ded adrwpueasine so tasasisfartsCttvgérés psueun Étttéuniéar d,lfort, garantédeam8217;anietérêtvgénérll,rforteme tadéctfc,ntrére,edéc,ntrali é.bsp;;:#187;M, a-t-ir emncu . br> s sLeNeolloe t JIReeteitauiue&Haïtrstrong>&/ dtl&4 et 5emarlrctmpnecdrabsp;: :s s821726; Und ntefénecc Cd8217;anoenrrtur,bsp;;:;s s821726; Druxe(2) ntefénecc s plénières générll s poroa.Msresrecéivemt.,esu al s rnjeux drclaereeoessauctionéet sur l8217;anéducasnnebsp;;:;s s821726; Und ntefénecc Cplénière théiatce téporoa.Msexcu divtmr tasurJles interventines urgentdsCetapost-urgentdsbsp;;:;s s821726; Seize (16)&sesinnes ouNatelierséthéiatce tsbsp;;:;s s821726; Quat ,e(4)&sesinnes croisédsCouNinter-théiatce tsbsp;;:;s s821726; Und (1)&synthèsr générll adeséateliers.s sLeNeomiéé de coordrnasineNdu cglloe t esp&ctmposéad bsp;: :ubrong class="spip">JIJean-Marie Bwurjgllystrong>&/, ptmfecirurNàa#8217;anÉcolendestscrdncrs ded aNgestnne àpl8217;avUeirseliéé du Québ ldà Modtréale(UQÀM)bsp;;:; brong class="spip">JIMaximdrDehouxstrong>&/, ingéniqur àelatreoraate etla.crdn gestnnenar dodrcgai es psmjetsn#8217;aningéniqrie à SNC-Lecaltnbsp;;:; brong class="spip">JIKerli eesMtb,lstrong>&/, ptenent Mt ded adJeuee chare ,ed fctmirree haïtruend de Modtréalbsp;;:; brong class="spip">JIYvne Ms scardystrong>&/, ingéniqur téexprrt-etnseai dn gestnneodrcgai es psmjetsn#8217;aninfrassauctur,bsp;;:;cbrong class="spip">JISamu,i Piersestrong>&/, ptmfecirurNdeNgéniq informatce téet&géniq logrc rl àa#8217;anÉcolenPolytechnce tbsp;;:;cbrong class="spip">JIPierse Ts ssarntstrong>&/, ptmfecirurNentscrdncrs dea 8217;anéducasnneéàpl8217;avUQÀM.s sPrce,ipauxpcteféneccierséduNeolloe t JIReeteitauiue&Haïtrstrong>&/ br> sD s personnaliéésé#edrenomeuarti,ipero.,ecomircprce,ipauxpcteféneccierséauNeolloe t dtl&4 et 5emarlràa#8217;anÉcolenPolytechnce téeesModtréal, iarmi lqsqurllqabsp;: :s s821726; brong class="spip">JIÉrcc CALAISstrong>&/, Ph.D., ptmfecirurNdeNgéophysii e àpl8217;avUeirseliéé denPurdultauxaÉttts-Ueis. Il0i8217;iatspprendu enéjanvreradernier&tnnHaïtrtec lduee ée ipetspécialtséepewur, ent ,eaut ds,easa yierJles causls dudtremblqmsntédeaterse eun12ajanvrera1510CetapourNévaluera atprmbabilitéé#edr se tsdmajdurs qii ps rroit.,ese ptodurre au nirsausded adflillqeEnsae illo,te i i8217;iaét ndujusqi8217;anen Répee ii evDomasccain,bsp;;:;s s821726; brong class="spip">JIPaul GÉRIN-LAJOIEstrong>&/, Ph.D., ptenent M dcclaeFondasnneéPaul Gérrn-Lejoid.éViceNpsscrer masatt ,etMémasatt ,eded adJeueesse du Québ ld# saolcslaenéesr1960-1966,éPaul Gérrn-Lejoid asétésleNurce,ipal autesan des ptofo ees mutations epeor éts auasystème d8217;iaéducasnneédu Québ ld#ura.,aladRévolusineNtiane ille.&Drp icl1977,dsonnornisatasineéphilanthtopae t se etnsacre àpl8217;avéducasnneéde bast eMélu=brueedes rnfa.Mssaissiéqi8217;anàa#8217;analphabéti asineéded durs psue.,sed saolcslmilieux&démunisn#8217;anAfrce t francgphoneert d8217;avHaïtrbsp;;:;s s821726; brong class="spip">JIRenald LEGENDREstrong>&/, Ph.D., ptmfecirurNémérite & dirtesq l du Cefear d8217;iaétu#es,é#edreehern esCet&deaconsultations lrxicologre ts endéducasnneé(CERCLE), Ueirseliéé du Québ ldà Modtréal. Enl1988,tlaemarcne Lars ssteédiMaetale Dicsinenarr lacéurl dea 8217;anéducasnneédeaRenald Legecdre,éet eNdrstribuai,od saol8217;anedeemblq des u ystuev adfrancgphonie. Enl1996,pl8217;avUeirseliéé denSherbrooket pdadsscrs ue DoctoratNJIhonorts causasti> endéducasnne,preetenaissa ,rla vale rfde&sesatravauxbsp;;:;s s821726; brong class="spip">JIGonzalo LIZARRALDEstrong>&/, Ph.D., ptmfecirurNadjoast & dirtesq l du Gtoupt de reehern e if#117;1;grif àpl8217;avUeirseliéé denModtréal. IleétudieélesNpsmcecius imp ce és psue es psmjetsn#e eteitauction, encu a ,bsp;: :u- LeNrôld tMélesNcaraesérrstce tlad c 8217;anauchctqctu ,e# saolaJcteitauction, -éLaegestnneodrcpsmjetsn#8217;anlménaglme taeta#aegestnneodrc 8217;anieformation, -éLaemaît i Cd8217;anoenrageéet eNdesrgnnornisatasinenrl,c-éLaereeoessauctionéapcèsélelécasassagphes natur,iess. Faisa.,eiartie d8217;anun asogaimir de reehern e àJlo c ter s,dsonntravailaportuespécifae tmr tasurJles eoesée te,esadedNdéciinnes ttratégre ts dedNdnenrurséd8217;anwsvrages, sur l8217;anornisatasineéeta#aegestnneoduNpsmcecius #e eteitauctiont p-même, enéfoncsineadps sôlts dedNuarti,iptcMseet&ded durs telasnonsbsp;;:;s s821726; brong class="spip">JIJacky LUMARQUEstrong>&/, rtesq l drcm8217;anUeirseliééaQu se tya & prenent M du0Gtoupt de travailasur l8217;anéducasnneétte#a&formationetnnHaïtr. IleaaéédedésrgnéCpsue eNPrenent M Prevalapour coordnenercle0Gtoupt de travailasur l8217;anéducasnneétte#a&formatione(Comiiiline prenent Mi lreNdo.,e eamandat rsp&dedptodurre ueéPacteénaonnelr sur l8217;anÉducasnne). M Lumari eeaaégalsme taassisoée eNPrenent M # saolaJmise en plac,adeséa ireaogaoupts de travailaresrecéivemt.,esu alaocomeétisiviéé,Cresétechnologrds drc 8217;anieformationéet&dealaenommunicasine, asréformltdrJlaajusM c ert #8217;avlme eeme ttdrJlaaCteitntutine de01987.&Il tsppégalsme tartesq l drcm8217;anUeirseliééaQu se tya (ueirseliéénrtivét àtbué&nonnlucratafafondée&enl1990CisuededNurmfecirursod8217;anueirseliéé en part daniasaec ldun gtoupt de sociéédsChaïtruendi)sdrp icldéc,re ,e2006, lpcèséenéacr aassuréllatirénent c, du0ha tpetnseai d,e2003 àt2006bsp;;:;s s821726; brong class="spip">JIB rnard McNAMARAstrong>&/, auchctqcteNPA LEED, ptenent M, Auchctqctes drc 8217;anurgenc, du0Casada. Ileaauarti,ipéNàcuneemiiline tnnHaïtrtsuittdauaséismledu 12ajanvrera1510. Auchctqctes drc 8217;anurgenc, anenvoyéNsurJplac,duee ée ipetd,epsmfeciinenelc&ctmposée d8217;avexpeuts&français dedNAntiiessaet du0Casada. Ilseevoisntépour miiline d8217;anévaluera sndommagesrewuralaesécuriéérdestrwpueasinesert d8217;avoffrcl drcm8217;anaide auxavicsimtsbsp;;:;s s821726; brong class="spip">JILauchlannMUNROstrong>&/, Ph.D., vice-prenent M Stratégrr générll aet&gestnneoRégionale, Cefear deaReehern e enédéveloep me t ent rnaonnelr (CRDI). Enl2004,uil aaéédenommé dirtesq l du Gtoupt des polctce ts et&dealaeplanificasine. Chargé en 2006tuev adfoncsineadp vérificasineNent rn Ceartielldme t emeartie,uil aaéédedésrgné,éenéacril 2008,oegt.,esupérrdureauxefins&de 8217;anarelicasnneédea adLoi sur latprmtecsineadps foncsinenarr sndirulgasdurs d8217;anaesps seprehensiblts.&Il rsp&dev duuvice-prenent M enéoctoe ,e2008. Chef&dealaeplanificasine ttratégre t àpl8217;avUNICEF, d,e2000 àt2003,uil aaa soietravaillé rwsdnl8217;avUNICEF # saouludidurs psyiar.Nvoie desdéveloep me t&tels e t,aladRépee ii evdémocratce tédu0Congo,ele Zimbabw ert #8217;avOugandabsp;;:;s s821726; brong class="spip">JIIsabrlle THOMAS-MARETstrong>&/, Ph.D., ptmfecirureoegrégée,eUeirseliéé denModtréal. Eere asfaiMNsneadoctoratNàelatSorb (ne,cPatise4 sur latthéiatce tédea 8217;anétalsme taurbainétte#a&ressaucturasineédes friches ind dtrirereséd saoledNviiessédea 8217;anOhio.nLeNPrix«nbsp;?LEugèn CGalloisbsp;;:#187;Mdaaéédeattribué àésonnosvragebsp;: :uMartteI. (2004). Étalsme taurbainéttefriches ind dtrireres,Ntevtrsa#ea#8217;anidéaleamérccain,dPatis,el8217;avHarmattan,d(220Cip),d#l 28ajuinl2004CisueLasSociééde#eaGéograr ietde Patis. SedNchamps #8217;anintérêtvportu tasurJlesdéveloep me t&urbainéttesaeplanificasine e,eiarticueièreme talaae tltionadea 8217;anétalsme t, d,emêmeNe t&ssdn#asreeoessauctionéapcèsécasassagpheétte#a&renelrdncrnnommuna iarr . Ces d rnièreslaenées, rere astravaillé rlus spécifae tmr tasurJles probléiatce tsa#earulnérlbilitééurbaine,crenelrdncrne,edéveloep me t&urbainé#urable.&Eere utili eélesNSIG (Systèmes #8217;anIeformationéGéograr ie t)srwsdnacéudlisera sndoenées, asa yiesret eart sdesst Mi lrelràats é stratégrr d,eplanificasine turJleslo c ter srd8217;anuee régionéurbaine.sbr> sbr> sJIComitéséthéiatce tséduNeolloe tstrong>&/ br> sDixNeomiééséthéiatce tséde travailao taéédedéfinns. Ilseso.,acteitntués d8217;avHaïtrens&de 8217;anietérrdure(Haïtr), d8217;avHaïtrens&de 8217;anextérrdure(diaspora),edcccitoyeesert d8217;avexpeuts&#ed annommuna ié ent rnaonnelrt. VoicrplaJltsé fdesNeomiééséthéiatce tsbsp;: :s s821726; Aménaglme tadudterritor do téenvirnenent.,bsp;;:;s s821726; Déveloep me t&éctfocre téet&ntedsineNd8217;avemploisbsp;;:;s s821726; Infrassauctur,s naonnelrelbsp;;:;s s821726; Reeoessauctionédee 8217;anÉtttéet gvenrrna c bsp;;:;s s821726; Sa>éé iee ii eétMérwpueasinebsp;;:;s s821726; Solidariéé t,edéveloep me t&socillbsp;;:;s s821726; Système éducasnfrhaïtruebsp;;:;s s821726; Pasrimoint,ocultur,ret entrepnnsesCeultur,iessbsp;;:;s s821726; Interventines urgentdsCetapost-urgentdsbsp;;:;s s821726; Planificasine globll aet&fasanc me t. br> s sLannoenrrtur, dpdNohè ssndsntravailaobéi,eauxesixeurce,ip sndirtesq ls survtcMsbsp;: :s s821726; JusM c eoocilld e,eiarticiptsine eitoyeen,bsp;;:;s s821726; DroiMNetaacceciibilitééauxesedvicds&de bast (éducasnne,psa.,é,édlime tasnne,peau uoélblt,uetc.)bsp;;:;s s821726; Ctetinuiéérdestactions posisnvesC(neNiasarepartir de zéro)bsp;;:;s s821726; Arrimagt ec ld#lepsyiaietérrdurecomircmisafestation de #ansolidariéé naonnelrebsp;;:;s s821726; Urgenc, ctmpatibrepec ld#lelo c ter sbsp;;:;s s821726; Déveloep me t&#urable (ptivilégrrroledNchoix qii prenerventoledNgénérltions fueu es).s sLeNGtoupt de réflrxioeert d8217;avactionpewurauneaHaïtrpnoenrere se ptopossed8217;anornisateraueeddruxièircrenntetre élargiee&#iase dérouleuatlu=ct rs du0mois&de maia1510. Cett ectefénecc Cent rnaonnelrtNregtouptradl8217;avedeemblq del#andiaspora haïtruend et&des amces/amisdd8217;iaHaïtrNde psue eNmonde, en plus dedNHaïtruendi/Haïtrens&de 8217;anietérrduredueu ys.sLeNGtoupt de réflrxioeert d8217;avactionpewurauneaHaïtrpnoenrere se joast àats é annommuna ié haïtruend du Québ ldewuraremercrrroledNcitoyeen,sret eitoyeesedu Québ ldet du0Casada,e eNgvenrrn me tacasadrue,e eNgvenrrn me taquébéctia,alatVilltsdraModtréal, lcslmédiasedu Québ l,saissiéqie ts spessaornisatmeseet&inssntutines qii o tcmisafesté&de manière ex mplarre leur solidariéé ec ld#lepeuple haïtrueNdut me tatouchéaparNccfcatac yimlts saourécéde t. Il0ialuepégalsme tal8217;avedgaglme tad anne tainesd ccitoyeen,sret dcccitoyees, do.,e41 personnlséd8217;anwrrgcne haïtruend,te i io.,eiartiiaverdeHaïtrpewurajoasdred durs effortsaàaneux drcmaie selédt steourtsé séveeus #e parts é d sao#enmonde, àelatrescs sstedes e tle tétroiscmaie nesadeapersonnlsédirtesqme taafftesédsCpsue eNuuissa ,rséismledu 12ajanvreradernier. br> s sPwuravoséins ripsinesert ts é aoieformationsesuppléie tairtsbsp;: :shttp://www.haiMi-grahn.ornsbr> ConoacMsbsp;: : Rodrce t Baugé,éRespnesabltadu0Comité de promoonne, _s é">rodrcgue.baug@sympatico.ca sNancy Roc,éRespnesabltad c atpromoonne eupcèséd slmédiasehors-Québ l,s_s é">rocptodz@yahoo.fr sReneergnent.,sbsp;: : Asdrée Peltrurs sReeasineseiee ii es Asdrée Peltrurs s514.846.0003 br> s_s é">apeltrur@ca.ent r.net sbr> br> s sJI12afévrrerr1510strong>&/sbr> sbr> sbrong class="spip">JIGuy Piersestrong>&/ ns spinformltdedc ttcfientitsivsdemporoa.Mepewuralaereeoessauctionéd aoiefrassauctur,s ueirseliéar dsCànHaïtr, telldme t néceciarre àe#a&formationedesNeadies&de 8217;anÉtttéet à leur marntrueed sao#enu ys.sbr> sbr> p>

JICOMITÉ INTERNATIONAL DE SOUTIEN A LA RÉALISATION D8217;avUN ENSEMBLE UNIVERSITAIRE POURsL8217;anUNIVERSITÉ D8217;avÉTAT D8217;avHAÏTIN(UEH)p class="spip">LLCteiidéranteqi8217;anil0tsp&urgent d8217;avappuyrroledNeffortsadu peuple haïtrueNd saolaJtân e deereeoessauctionéd ésonnu ystu saounuctfeextd desdéveloep me t&sout duuafasnqi8217;anil0p icir turmonter asogaeciivlme taetadèséleléprmn aisaomois&latliéuréionNdraiatce técréée psue eNtremblqmsntédeaterse eun12ajanvrerapassée téendmêmeNtempscm8217;anaider àeélevtrésonnnirsausdedvrebsp;;:;s sCteiidéranteqiepu saoc nbué&#lepsyiadoiMNs8217;avappuyrrosu adps inssntutines solides, eomircmevdémontree 8217;anhistoirq de ts spessau ystuevpsue eNmondebsp;;:;sCteiidéranteqiepm8217;anUeirseliééaeteitiéueaueeddroc sninssntutines majduresdéoa./ndoenéaqi8217;anil0extsé fund étroit ectrréeasine tfear déveloep me t& téeneergnent.,esupérrdurede0ha tpnirsaubsp;;:;s sCteiidéranteqiepm8217;anUeirseliééanaonnelre e8217;anHaïtrbsp;;::ll8217;avUeirseliéé d8217;anEtttéd8217;iaHaïtr(UEH)NdoiMNet peutnassumera at hargtset eNrôld de formationedesNeadies&scrdntifae ts, socitux etecultur,is&#ed anNasnnebsp;: :uAgtonomts, Auchctqctes, Ingéniqurs, Médecins, EneergntcMseet&ehern e rsaendScrdncrs Humainqsnet&Socillds,oTechnccruescsupérrdurs821730;etc821730;s sCteiidéranteqiepmesndiffénecMesdfaculéésade l8217;anUeirseliéé d8217;anEtttéd8217;iaHaïtrNrépsutnes&u saodepnore ,ux&lieux&deela capitalldPor -au-Prie,e, o tcsouffertédeetrès emporoa.Mssdommagesrà la suittddudtremblqmsntédeaterse &#iaassteoué&#lepsyiaeteqiepuludidurs d8217;iaedtre- lrelrio.,etotalsme tahorsa#8217;anétap&dedfoncsinenerbsp;;:;s sCteiidéranteqi8217;anil0connie./nqiramesndiffénecMesdFaculéésade l8217;anUEHrioie tartgtoupédsCsur&un eittdunce t,ouee Ciéé Ueirseliéar doouuueaCsmpus comircm8217;aniediqilsra&uénomasaonnesdeenodeursrlrlaNplus cgura.,tbsp;;:;ccecied sao#enbutéd8217;anen raonnelrisera nfoncsinenent.,ee,eiar eoesée teted8217;anornisateraueedrépsutnonnesrasinenrlld e,eiondéréeadedNdépenses& ntrenl s sedvicds&et usaglrsod8217;anueefpartacomirc#8217;anétabliueued viedaeadémce t eollecéive& ntrenurmfecirurs,&ehern e rsaet&étudia ,sbsp;;:;s sCteiidéranteqi8217;anàanestt fasnl8217;anUEHra besoinod8217;anueefdotation fasancièredemporoa.Me, rwsdnlaqurllq rllq neNpeutn-ena 8217;anétat dccchosesnacéurl-=ctmpt,rosu aseléprmprestressourcds&niCsur&un fasanc me taaue ic, lcslressourcds&de l8217;anEtttéHaïtrendéoa./nréduitdsCdedfaçonNdraiatce téà la suittddudtremblqmsntédeaterse etapourNueefduréeCemprévisibltdéoa./ndoenélsra&uessauctionédee 8217;animirublq del#andirecsineagénérll adeséempôts ec ldts é saadocume tasnne,plestdégâts qii afftesentoledNprce,ipauxpportsadu psyiaiar oùcpassentoledNéehangeséeteio.,eierç es ltl&tax sndouanièreslmaisda soie nfoncsinenent.,eeunmarchéaietérrdur.&Il fa tpégalsme tapnecdre enantmpt,elds a ireacgai es invessicirnt.,s deereeoessauctionéàerélriserad saol8217;anurgenc,bsp;;:;s sCteiidéranteqiepues ueirseliéés,afondatines scrdntifae tsCetecultur,iles internaonnelrel,pues ueirseliéairea,aint llqcéurlsetMém,re ,sededNurmfeciions fasancièrea,aind dtrirereséet ibérll s,ccitoyeesert décideurs d saonore ,ed fu ystuuaModd, so Méconscrdntstdedc ttcfliéuréionNeteio.,edisposéseàlaider l8217;anUEHrd saosonnusmjet&deantedsineNd8217;avun espacr adapté àelatréali asineéetNàelatcapacaté d8217;ans="umerade manière efficace&sesarespnesabilités enverdellepeuple haïtrueNrt #8217;avEéltndedc fu ystfrèr,bsp;;:;s sIl rsp&ptoposée#a&renolusineNsurvtcMebsp;: :s s s8261656; Es,acteitntuénàtiartir de ceeursr,oec ld#8217;anacctrdrformllert tstal uuaRectoratNde l8217;anUeirseliéé d8217;anEtttéd8217;iaHaïtrNuerbrong class="spip">JIComité Int rnaonnelr dedsoutrueeàolaJcteitauctionod8217;anueefCiéé Ueirseliéar do(Csmpus ueirseliéar d)eàoPor tlu=Prie,e.strong>&/sbr> sbr> s8261656; LeNComité ent rnaonnelr dedsoutrueeaapourNobjet deereeueaie un Ceartieasubssa Mi lreNdps fones néceciarres àelatréali asineépsue 8217;avUEHrd8217;avun Csmpus Ueirseliéar domod rnedeteiûr. C8217;avtsp&àndire0napabltade renesterCauxpcyclonqsncyclce tse&#iant.act.,ee,ent.actro talefu ystec lduee fréqse ce renoenreéedeissiéqie latréali asineédes bâtint.,s sesosJ#lsrtechnce tslaeti-nesmce ts&mod rneseper sttantédearenesterCauxpséismlstdedgai es0amplitude.sbr> sbr> s8261656; LeNeomiéé set hargtrandsntransféneroledNmonoa.tsereeueaie aaaux&lutwsatésocomeétecMesdde l8217;anUEH, lqsqurllqaéenéaccusero taréceptionédeemanière officielldretéen renervero.,ela tstaliéé txcu divtmr taàolaJcteitauctionodrJlaaCitééueirseliéar d-Csmpus.dSouaaaucun aséeextd etapourNaucuneprarcne l8217;anUeirseliéé d8217;anEtttédeaHaïtrpne ps rro utili e un Ceart e tlcteqiepues drtsCmoyeesefasanciels sus-iediqiésrewurae tle télut ,eaesivatécouNdestasaonnes e t eedsoit.nEt ctsb r.Nqi8217;anel eNuuisseéacr abesoinodeerégleu des coûts edminattratifséeteialaniaux.sbr> sbr> s8261656; l8217;anUeirseliéé d8217;anEtttéd8217;iaHaïtrNaue itrants spessasix(6)omois&auxefins&de transpsue.ceCemprimééet sur sonnsitq informatce téunadocume t officielret et>trôlénueNétat détlillé dedNdépenses&réali éts auanirsausded 8217;anavanc me tadpdNoravaux. LeNComité vérifitranc t Etttéenantopératineset etordrnasineNec ld#8217;anUEHret ueecorpstup vérificaseurs arearteea taàdun gtoupt de Comiiilarres auxeCtmpt,sert d8217;avAudiseurs fiabltl&eppde réputation ent rnaonnelrtNiediscutde ebsp;;:;sbr> sbr> s8261656; LeNeomiéé setdissoudraduee fois #es travauxedetréali asineédeJlaaCitééUeirseliéar d-Csmpus achevesaetaapcèsévottddude iéusndoené psue es Audiseurs, Comiiilarres auxeCtmpt,sert Expeuts&Ctmptabltl&cg>c rna.,e 8217;anachèv me tadpdNoravauxétte#a®ulariéérdestfasanc me tsbsp;;:;sbr> sbr> s8261656; LeNComité urce,ipal seraNassisoéeisuediffénecMseeomiéésénaonneluxedo.,ela foncsine cteiesteranenolaJctllqcéeNdps fones auanirsausnaonnelr et&ded dsntransféneroaueCtmpt, bancar doe t&l Comité Prce,ipal ouvrirand saolaJbaeqiepueusoedchoix.&Il rn iediqilranàanestt fasnle&lieu (agenc,) tMélesNcaraesérrstce tladu=ctmpt,bsp;;:;s8261656; LeNComité urce,ipal désrgnlransoedTrenorreradesnaonnelritééauir fe 8217;avHaïtrenneNdo.,eilarecdradaue icsulaasasnnelrité,Cresétitresret réféneccds&et domiciliasinebsp;;:;s sbr> s8261656; LaNPrenent ctadu0Comité urce,ipal seraNoccupée psue eNpsmfecirurNLesl reManigat,aacctmpagné de onois Vice-Prenent Msbsp;: :s s829679; Josep Brccall, ptmfecirurNémérite de l8217;anUeirseliéé dt Bareelone,cPrenent M honorar dodrcl8217;anA="ociltioeedps stesq ls Eutopéensbsp;;:;s s829679; John Coaswor h, ptmfecirurNémérite de l8217;anUeirseliéé dt Harvardbsp;;:;s s829679; Her ann Van der Wee, ptmfecirurNémérite de l8217;anUeirseliéé casholce tédeaLeenrn(Louveis)sbr> sbr> p>

LLbrong class="spip">JIM,re ,sedu0Comitéstrong>&/ (iar ordre alphabétie t) br> sPrenent M br> soeManigat,aLesl r, histosaue,epolctologue, ptmfecirurNémérite de l8217;anueirseliéébsp;;:;s sbr> sVice-Prenent Ms br> soeBrccall yeMasip, Josep,aRectrurNHonorar dodrcl8217;anueirseliéé dt Bareelone,cAncrueNPrenent M #rcl8217;anA="ociltioeedps stesq ls Eutopéensbsp;;:;s so Coastwor h, John,cPrmfecirurNémérite de l8217;anUeirseliéé dt Harvard, DoyeeédeJlaafaculéérdes telasnonsnInt rnaonnelrel,eUeirseliéé denColumbia (NY)bsp;;:;s so Van der Wee, Her ann, ptmfecirurNémérite de l8217;anueirseliééédeaLeenrn(Louveis)sbr> sbr> M,re ,ss s829679; Alba Vega, Carlol,em,re ,Ndu cg>seai d,edirecsineadu0ColegiosdraMrxicoo(COLMEX)bsp;;:;s s829679; Brod r, Albert, ptmfecirurNémérite de l8217;anUeirseliéé dt PatiseEs,-PatiseXII s s829679; Chiaramonte, José Carlol,eptmfecirurNhonorar dodrcl8217;anUeirseliéé denCordoba (Argentine), Dirtesq l drcm8217;anInssntut deereehern esCpolctce ts et&oocillds #171;nbsp;?LEmilio Ravrgntcibsp;;:#187;M, Bse os Airtsbsp;: ;s s829679; Colliard, Jean Claude,dptmfecirurNdeNScrdncrs polctce ts,la.crdn dirtesq l du cabinet du0prenent M #rcl8217;anA="emblée Naonnelre,la.crdn m,re ,Ndu Cg>seai eteitntutinenrl,cprenent M #rcl8217;anueirseliéé dt PatiseI- Panthéon, Sorb (nebsp;;:;s s829679; Hector, Michel, histosaue,eptenent M dcclaeSociéédehaïtruend d8217;avHistoirq et&dedGéograr iebsp;;:;s s829679; Iglesias, Enrce t,oa.crdn masatt ,edes telasnonsnextérrdures&#ed anRépee ii evOsaee,aldodrcl8217;anUruguay,oa.crdn ptenent M dcclaeBaeqiepInt ramérccain,edccDéveloep me t,as,crééar dogénérll dcclaeIberoamercca, Madridbsp;;:;s s829679; Ocsmpo José Antonio,&éctfocrste,la.crdn m,re ,Ndu cg>seai d,edirecsineadrJlaaCtmiiiline éctfocre téet&socilld des NasnonsnUeies (ECOSOC),cPrmfecirurNàpl8217;avUeirseliéé denColumbia (NY)bsp;;:;s s829679; Perez Rocha, Manuel, Rtesq l drcm8217;anUeirseliééaautonomtadrJlaavilltsdraMrxicobsp;;:;s s829679; Stec nhagen, Rodolfo,em,re ,Ndu cg>seai d,el8217;anueirseliéé ewuralaepaix d,el8217;anornisatasineédes NasnonsnUeies, ptmfecirurNau0ColegiosdraMrxicoo(COLMEX)bsp;;:;s s829679; Teodoro, MariosLisboa,&éctfocrste,lm,re ,Ndrcm8217;anInssntut deereehern eert d8217;avEctfocre App ce ée (IPEA),cBrenelbsp;;:;s s829679; Théodat,aJean-Marie,Ngéograr e, Maîear deaCtefénecc s -Ueirseliéé dt PatisePanthéon Sorb (nebsp;;:;s sAdress éaqctng>ce tbsp;;::s_s é">ueirseliéehaiMi.soutrue@gmail.ctm sPwuraieformationbsp;;::sGuy Pierse, ptmfecirur,eUeirselidad AutófocaédeJlaaCiudad draMéxicosbr> br> s p>

LLUeemailcd éé du brong class="spip">JI30ajanvrerstrong>&/ dt brong class="spip">JIPaorickCTardrdustrong>&/, cg>servasq l drcmaeBHPSE et&dealaebie iothèe tédea 8217;anUeirseliééaQu se tyasbr> sbr> M,rc édeavr spinquiééerapwuralaebie iothèe téhaïtruend des pè ,sedu0SarnteEspni,.sbr> sCepecda.,evs spaviez ts sprarcne. Maiiavs spaviez ts spa soietor . A0SarnteMartill il0extsé f4ebie iothèe ts. br> 1. Laebie iothèe tédes pè ,seouNdes sémasartsé s,ebie iothèe tételigrdust (édifice du arimaire)bsp;;:;s s2. laebie iothèe tédu arimaire (édifice du arimaire)bsp;;:;s s3. Laebie iothèe tédu steondar d (édifice du steondar d)sbr> s4. Laebie iothèe téhistosae t (édifice des pè ,s).s sDtse&#at ,,pueuxpso.,ecomplèttmr taàoterse. Uee eresqirass spessadéctre ,s. Ete#8217;avlut ,,&cellqee tédeaparts é on veutnacr adrs noenreresésurJpied,CmaisdladliéuréionNesp&iréoccupa.,t,uj8217;anen connie.s.sbr> sbr> _docume t_831 ip">_docume ts ip">_docume ts_cee, r' JIDomasce t Simonstrong>&/ estaàolaJbarre àePor -au-Prie,e.sbr> s3. B (ne noenrere, brong class="spip">JIPaorickCVilarrestrong>&/ penseoe t&l bâtint.,pne r se tNiasaueus8217;aneffonerer. br> s4. brong class="spip">JIHarold Gaspsudstrong>&/ &#iafut dirtesq l du pasrimoint et&dirtesq l générll du Misattè dodrclaeCultur,rdoiMNvisiteralaebie iothèe télundr.s s5. Uneemiiline dt brong class="spip">JIBie iothèe téS saoFro.,ière, AuchctqcteéS saoFro.,ière, Bouc itr Bldustrong>&/ (&#iaas 8217;anhabitude #8217;aninterv diuédeapare eNmonde&u saodesdliéuréionsdlimilar dsCpwurapnmtégss e pasrimoint),Nteetre égalsme tajeud àlSa>éovDomasgoCpwurasetdirigss àePor -au-Prie,e.sbr> s6. Laemiiline viecdradec ld#lenéceciarre pwurafarre uneNpsscrèredenterventine. J8217;any sealr égalsme t.sbr> sbr> _docume t_832 ip">_docume ts ip">_docume ts_cee, r' JIBie iothèe téet Auchcves Nasnonllds du Québ lstrong>&/ vo.,eterminercunetravailaentrepnnsaàolaJBHPSE. Laenumérc asineédeJonois rev tséde jeueesse, et&des auchcves surJJIRarasti> etNJICarnecal #8217;anOdestt Meen,ssoedRigaudsti>. D sao#entemps,Creséjeuees se pecchoit.,essdnl8217;avav diuédu psyiar.Ntempscdeantise. C, so Mé#171;nbsp;?LJIRev todrclaelig todrclaejeueessesti>bsp;;:#187;Md1917bsp;;:;c#171;nbsp;?LJILaerelèvdsti>bsp;;:#187;Md1932-1938bsp;;:;ceMé#171;nbsp;?LJIRondePorntsti>bsp;;:#187;Md (vs spetenaissezbsp;;:?)821730; Bit.,ôé on lqs mettranenolrgnlceM/ouNssdnDVD.sbr> sUn plan d8217;avactionpesp&irévu, et&neédiscuttrandsncrlaràePor -au-Prie,eadèsémneNertivét. br> sCi-joast égalsme tales drsct rs lorsa#ea#8217;anasaugurasineédealaebie iothèe téenl1929,e eNPèredCabneépsciartalefflambeau àpl8217;avAmccale des Ancruescet&Amisddu PSCSM.bsp;: LaJtân e tsp< rde. D sao#es drsct rs, o aremari eee t&l moMs#171;nbsp;?Lpersonnaliéébsp;;:#187;Mdrevie./nqiat ,efois. C,stt bie iothèe tées/ndoecllatiersonnaliéé du peuple haïtrue, rere doiMNdoeclvivre.sbr> sM,rc sbr> sbrong class="spip">JIPaorickCTardrdustrong>&/, cg>servasq l drcmaeBHPSE sbr> br> s p>

LLUeemailcd éé du brong class="spip">JI22ajanvrerstrong>&/ dt brong class="spip">JIJacky Lumari estrong>&/, rtesq l drcm8217;anJIUeirseliéé Qu se tya btrong>&/sbr> sbr> p> <_docume t_853 ip">_docume ts ip">_docume ts_cee, r'

JPG - 56.3 ko_doc_titre' style='width:350px;'Lbrong cIJacky Lumari e. PhotoeMauriciosLattrre RFIbtrong>&/p>dt> p class="spip">LLbr> p> <JINJIEntrevistanenoespañolarealizadaaporeMauriciosLattrre RFIbsp;;::sti> strong>&/ br> sembed p>objecs/sbr> sbr> sbobjecs width="370" height="275" pparam namt="movre" valuesphttp://www.dailymoonne.ctm/swf/xcdcdv" p>paramLbparam namt="allowFullS reen" valuesptrue" p>paramLbparam namt="allowS ripsAcceci" valuespalwsyi" p>paramLbembed typt="arelicasnne/x-shockwav -flash"Nsrc=phttp://www.dailymoonne.ctm/swf/xcdcdv" width="370" height="275" allowfulls reensptrue" allows ripsaccecispalwsyi" p>embed p>objecs/br> / pb> br> sCherlrctllèg ts et&amis C8217;avtsp&monnusscrer conoacMNec ld#8217;anint rn tadrp iclre séismledenmardr. Jenm8217;avtxcuse eupcèséd slamisde témonnsilenc, anpupinquiééerbsp;;:;cmaisdj8217;anééarsetrès ctfc,ntrérsurJles opératines deerécupérasineédes ssdviva tsert #8217;avlide auxafamilessasisatt é,s. Ma connictionpéMaetadq neNjamaisdcecierJles opératines deesauvetagt ect /n#8217;anacr alaJctefirmationeqiramesnpersonnlséreehern éts éMaee./nb r.Nmortus. VoicrplaJliéuréion.sbr> sJ8217;avliNertêédedéfinnéivemt.,edrp iclhieralaereehern eede ssdviva tsert jtNsuisdfasalsme tadn m,su dodrcsortir desadéctre ,sélesNcadav ,séent Mifiésbsp;: : 5&étudia ,sédeJlaafac destscrdncrs ded 8217;anéducasnneédo Mé2 abbésé#ed annongrégasineédes Salésiees, un aèr,ret ueeesœ l drcmaenongrégasineéde Stt Cnoix, un atmfecirur,eun ingéniqur tédruxNjardrniers. Ns spsaurosaoc nmatinus8217;anil yea d8217;ava ireaovicsimtseqiramesnpersonnlséent Mifiées.sbr> sbr> LesNcadav ,séso MéenédéctmposisineNecancé,ret ns spavnes dûntransformlr rapieeme ttuee cit rn Cen carsau, od saol8217;anespacr du jardrn botasce t. Ce&lieu seraN eamausolée dédié auxavicsimts du séisml. brong class="spip">JIMgdnDumasstrong>&/, leléprmvce,iauxedesenongrégasinesé#edDneNBosct et&deaStt Cnoixtdiro ttuee mess à midiNpourJles défu ,s. Ceuxd&#ianeNpeuventoêtrenuhysii eme tapnése ts ns spacctmpagnero.,ede leur penséedefftesudust.sbr> sbr> Jearemercrrtspécialsme tales étudia ,sétMélesNjeuees vmlg>éar dsC(do.,ela plueart n8217;ano tcmêmeNiasafartaleurecrrtnficas d8217;iaétu#es arimaires)NpourJle cguragtsextraordrnar dodo.,eilsao tafartaussuve& nstravaillt /n48dhdures d8217;anaffieéedefinodrcsortir desadéctre ,sépcèséd8217;anueefvingtainesde ssdviva ts,ts saomoyeesetechnce tsleMélu=pérrlede leur vie. Ceuxd&#e ns spavnes vu0mourirdsousenodeyeuxpso.,emortsafa tledenmoyeesert d8217;avée ipeme ts pourNéeart rJles poutresret reséd llqaéentrenl squrllqaéltl&cgrpstseJonouvoisntécoce,és. br> sbr> Tousenodebâtint.,s o taéédedétauitdeyrctmpniclre Muséed&#iaaccueaieartaueefexposisineNetnsacrétdauacélèe ,Npeint ,eamérccainéd8217;anwrrgcne haïtruendubrong class="spip">JIJean Michel Basquiatstrong>&/ et reséonois areartent.,s &#e ns spavinesé#édié auxaurmfecirursoinvités en miiline d8217;aneneergnent.,epourNQu se tya et reséa ireaoueirseliéés haïtruendipreeten tslpsue 8217;avEttt. Ns spdevrosaoreetmmdncrs àezéroert jtNn8217;avliNeucun ds é surNnotss0capacaté eollecéive&àJonouveroledNmoyees, 8217;anénergieette#a&déterminationpewuralt far d.sbr> sbr> _docume t_854 ip">_docume ts ip">_docume ts_cee, r'
JPG - 82.2 ko_doc_titre' style='width:350px;'Lbrong cIUeirseliéé Qu se tya. Photobsp;: :uMauricosLattrre RFIbtrong>&/p>dt> p class="spip">LLPwurad#8217;aninssa M, brong class="spip">JIQu se tyastrong>&/ seJémobili e pwurav diuéenéaide auxafamilessasisatt é,s. LeNesmpus du boulevard Harry Trumandaaéédetransformé en ueecefear d8217;iaaccueai oùc10,000 personnlsésisatt é,s deaCiéé L8217;iaét rn leio.,edéjà&insoallé,s. LesNCefears Gheskio et&des médecinseamérccainsNassisoe tales maladesret resébltlsés. TOUSales étudia ,séfinnssa ,sédeJlaafac de Médecine drcQu se tya io.,einvités àav diuéns spasnesterCd saol8217;anornisatasineédeJlaavirnnommuna iarr ette#a&dispensasineédes soins&de bast. Ns spatt ndnes e t l8217;avedceintedsoitesécuriséed(les mursa#eaclôtur,rio.,eàaremettrenen plac,) ect /n#8217;anefearrnd saolaJdrstribuonnesdeenourriture, efinod8217;iaévit rJles actes drcpaieagd.sbr> sbr> L8217;anesplasadtset eNpsuking du campus de Turgeau serost égalsme tatransformés en ueecefear de soins&pourJles sisatt és. Comircns spsomirs&insoallésdts éépcèsédu renervr aurce,ipal drclaeCentralenmétropolctainesd8217;aneau uoélblt,uns spehern osaoàamettrenen plac, uneNpetittdusine drcoraatemteted8217;aneau efinodrcptodurre 3cmaiee gallonssd8217;aneau uoélbltlpsueursr,oqii ps rro.,edessedvirélps senent Msret resé#171;nbsp;?Lcoloeiesbsp;;:#187;Mddes e artiers pércphérce tsl(Turgeau et Debussy). Ns spatt ndnes uneaaide dt brong class="spip">JIAidtset Actionstrong>&/ pwurafarre v diuédealaebrong class="spip">JIRépee ii evDomasccain,strong>&/ les ée ipeme ts pourN#8217;aninssallasineNdu cefear de oraatemteted8217;aneau. LesNétudia ,sédeJQu se tya io.,einvités àase etnstiéuer en ueerenrautdr solidariéé ueirseliéar d. C8217;avtsp&enéaidantoledNplus fragiles e 8217;anilsJonouvero Méenéeux-mêmes 8217;anénergieette#8217;aninspirationpewuraornisateralaereeoessauctionéd leur vie personnllldretéded 8217;anespacr eollecéif.sbr> sbr> L8217;anaide ent rnaonnelrtNtsp&abneda.Mepmaisdmal coordnenéd tMélesNfruttratines so Mégai ess. Ladrwpueasine s8217;avtsp&spnesa éme t ornisatée&enl#171;nbsp;?Lcoloeiesbsp;;:#187;Mde e artiersbsp;;:;cil fa tpsout diroc snssauctur,s en lqs aidantoà s8217;avornisateradeemanière rasinenrlld,dts ééen caelrisantoledNsteouriaverdeledNplus néceciiseux.sbr> sbr> sM,rc éà ts spnodeamisdpourN#8217;anexpressioeed leur solidariéé t,ed leur efftesine. Le plus dur sp&devantons spe andcil fa dradreeteitauiue&e/nqiramesnél saodepsolidariéé spnesa ée&e/nimmédiatedserost ép icés. Ce seraN auxaHaïtrens&de s8217;avornisateraeux-mêmes ec ld#8217;anaide dt renrauxn#8217;anlmisasolidar dsd&#ianeNio.,eiadNmoéivés excu divtmr tapsue aereehern eede laaviiibilitéémédiatce t.sbr> sbr> JINJINAuchcves SLALbsp;;::strong>&/ sti> sa href="http://www.amerce tlatine.msh-patis.fr/ip">.php?article286" targtt="_bl skJILaëenrc HurbandauasasosJ09.php?article121" targtt="_bl skJIJacky Lumari e, Rtesq l drcm8217;anUeirseliééaQu se tyasta p> br> ass="spclear" / b/div>
b/div> Partaglr : div> p>div>